Overview

  • Product name

    Anti-Procathepsin L + Cathepsin L antibody
    See all Procathepsin L + Cathepsin L primary antibodies
  • Description

    Rabbit Polyclonal to Procathepsin L + Cathepsin L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Procathepsin L + Cathepsin L aa 104-149.
    Sequence:

    KVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEG


    Database link: P07711

  • Positive control

    • HEK293T, sp2/0 and PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.0975% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 38 kDa.

Target

Images

  • All lanes : Anti-Procathepsin L + Cathepsin L antibody (ab200738)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 38 kDa

References

This product has been referenced in:

  • Zapatero-Belinchón FJ  et al. Characterization of the Filovirus-Resistant Cell Line SH-SY5Y Reveals Redundant Role of Cell Surface Entry Factors. Viruses 11:N/A (2019). Read more (PubMed: 30893855) »
  • Galetto L  et al. Two Phytoplasmas Elicit Different Responses in the Insect Vector Euscelidius variegatus Kirschbaum. Infect Immun 86:N/A (2018). Read more (PubMed: 29531134) »
See all 2 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Dog Cell lysate - whole cell (MDCK2 cells)
Gel Running Conditions
Reduced Denaturing (12.5%)
Loading amount
25 µg
Specification
MDCK2 cells
Blocking step
Odyssey Blocking Buffer 0.2x in TBS as blocking agent for 30 minute(s) · Concentration: 20% · Temperature: 25°C

Herr Dr. Vladimir Milenkovic

Verified customer

Submitted Jun 27 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up