Overview

  • Product name

  • Description

    Rabbit polyclonal to PRODH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PRODH aa 170-220 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    DGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYANEAKCDSHMETFLRCI E


    Database link: O43272

  • Positive control

    • Rat brain and mouse kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 68 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe please use dilutions of 1/50-1/200.

Target

  • Function

    Converts proline to delta-1-pyrroline-5-carboxylate.
  • Tissue specificity

    Expressed in lung, skeletal muscle and brain, to a lesser extent in heart and kidney, and weakly in liver, placenta and pancreas.
  • Pathway

    Amino-acid degradation; L-proline degradation into L-glutamate; L-glutamate from L-proline: step 1/2.
  • Involvement in disease

    Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) [MIM:239500]. HP-1 is a disorder characterized by elevated serum proline levels. May be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome.
    Defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4) [MIM:600850]. A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
  • Sequence similarities

    Belongs to the proline oxidase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSPOX2 antibody
    • mitochondrial antibody
    • P53 induced gene 6 protein antibody
    • p53-induced gene 6 protein antibody
    • PIG6 antibody
    • POX antibody
    • PROD_HUMAN antibody
    • PRODH 1 antibody
    • PRODH 2 antibody
    • PRODH antibody
    • PRODH1 antibody
    • PRODH2 antibody
    • Proline dehydrogenase antibody
    • proline dehydrogenase (oxidase) 1 antibody
    • proline dehydrogenase (proline oxidase) antibody
    • Proline dehydrogenase 1 antibody
    • Proline dehydrogenase 1, mitochondrial antibody
    • Proline oxidase 1 antibody
    • Proline oxidase 2 antibody
    • Proline oxidase antibody
    • Proline oxidase, mitochondrial antibody
    • Proline oxidase, mitochondrial precursor antibody
    • SCZD4 antibody
    • TP53I6 antibody
    • tumor protein p53 inducible protein 6 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling PRODH using ab203875 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling PRODH using ab203875 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up