Calcitonin (human), bone resorption inhibitor (ab142264)
Key features and details
- Bone resorption inhibitor
- CAS Number: 21215-62-3
- Purity: > 95%
- Soluble in 5% acetic acid
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Calcitonin (human), bone resorption inhibitor -
Description
Bone resorption inhibitor -
Biological description
Bone resorption inhibitor. Calcium regulating hormone and bone density conservation agent. Active in vivo and in vitro. Orally active -
Purity
> 95% -
CAS Number
21215-62-3 -
Chemical structure
Properties
-
Molecular weight
3417.88 -
Molecular formula
C151H226N40O45S3 -
Sequence
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP (Modifications: C-terminal amide; Disulfide bonds: 1-7) -
PubChem identifier
16161965 -
Storage instructions
Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in 5% acetic acid -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
SMILES
CCC(C)C(C(=O)NCC(=O)NC(C(C)C)C(=O)NCC(=O)NC(C)C(=O)N1CCCC1C(=O)N)NC(=O)C(C)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C2CCCN2C(=O)C(CC3=CC=CC=C3)NC(=O)C(C(C)O)NC(=O)C(CC4=CN=CN4)NC(=O)C(CC5=CC=CC=C5)NC(=O)C(CCCCN)NC(=O)C(CC(=O)N)NC(=O)C(CC6=CC=CC=C6)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)O)NC(=O)C(CC7=CC=C(C=C7)O)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(C)C)NC(=O)C(CCSC)NC(=O)C8CSSCC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N8)C(C)O)CO)CC(C)C)CC(=O)N)N -
Source
Synthetic
-
Research areas
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab142264 has not yet been referenced specifically in any publications.