Exendin-4 (Exenatide), GLP-1 receptor agonist (ab120214)
Key features and details
- Potent GLP-1 receptor agonist
- CAS Number: 141758-74-9
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Exendin-4 (Exenatide), GLP-1 receptor agonist -
Description
Potent GLP-1 receptor agonist -
Alternative names
- AC 2993
- Exenatide
-
Biological description
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM).
-
CAS Number
141758-74-9 -
Chemical structure
Properties
-
Molecular weight
4186.61 -
Molecular formula
C184H282N50O60S -
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: C-terminal amide) -
PubChem identifier
45588096 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
This product is supplied in one (or more) pack size which is freeze dried. Therefore the contents may not be readily visible, as they can coat the bottom or walls of the vial. Please see our FAQs and information page for more details on handling.
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Toxic, refer to SDS for further information.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
-
Chemical Structure - Exendin-4 (Exenatide), GLP-1 receptor agonist (ab120214)2D chemical structure image of ab120214, Exendin-4 (Exenatide), GLP-1 receptor agonist
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (4)
ab120214 has been referenced in 4 publications.
- Pan X et al. High Glucose Attenuates Cardioprotective Effects of Glucagon-Like Peptide-1 Through Induction of Mitochondria Dysfunction via Inhibition of ß-Arrestin-Signaling. Front Physiol 12:648399 (2021). PubMed: 34054568
- Géa LP et al. Reduction of hippocampal IL-6 levels in LPS-injected rats following acute exendin-4 treatment. Naunyn Schmiedebergs Arch Pharmacol 393:1303-1311 (2020). PubMed: 32363414
- Pan X et al. Essential Role Of High Glucose-Induced Overexpression Of PKCß And PKCd In GLP-1 Resistance In Rodent Cardiomyocytes. Diabetes Metab Syndr Obes 12:2289-2302 (2019). PubMed: 31807042
- Brown JD et al. Oleoylethanolamide modulates glucagon-like peptide-1 receptor agonist signaling and enhances exendin-4-mediated weight loss in obese mice. Am J Physiol Regul Integr Comp Physiol 315:R595-R608 (2018). PubMed: 29949410