omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)
Key features and details
- Ca2+ channel blocker (P and Q type)
- CAS Number: 145017-83-0
- Soluble in water to 1mg/ml
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) -
Description
Ca2+ channel blocker (P and Q type) -
Biological description
Synthetic peptide, originally isolated from Agelenopsis aperta spider venom. Selective blocker of Cav2.1 (P/Q type) channels.
-
CAS Number
145017-83-0 -
Chemical structure
Properties
-
Molecular weight
5202.25 -
Molecular formula
C217H360N68O60S10 -
Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bonds: 4-20, 12-25, 19-36, 27-34) -
PubChem identifier
56841669 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water to 1mg/ml -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Refer to SDS for further information
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
-
Chemical Structure - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)2D chemical structure image of ab120210, omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type)
-
Functional Studies - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)Sargoy et al PLoS One. 2014; 9(1): e84507. Reproduced under the Creative Commons license https://creativecommons.org/publicdomain/zero/1.0/Many VGCC subtypes contribute to calcium signalling in ganglion cell bodies.
Summary of Ca2+ imaging results in RGC somata showing the following changes in paired pulse Ca2+ signal in response to drugs (applied during the second K+ pulse) compared to their control paired K+ pulses (K): 10 µM nifedipine (29%±7%; p = 0.0003; n = 20), 100 µM verapamil (VPM; 39%±5%; p<0.0001; n = 17), 400 nM ω-agatoxin IVA (AGT; 35%±14%; p = 0.0364; n = 9), 3 µM ω-conotoxin-GVIA (CTX; 23%±10%; p = 0.0423; n = 15), 3 µM mibefradil (MIB; 21%±6%; p = 0.0011; n = 16) and 200 nM TTX (40%±9%; p = 0.0004; n = 14).
(From Figure 7C of Sargoy et al).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (7)
ab120210 has been referenced in 7 publications.
- Bian S et al. Exosomal MiR-4261 mediates calcium overload in RBCs by downregulating the expression of ATP2B4 in multiple myeloma. Front Oncol 12:978755 (2022). PubMed: 36091107
- Toft-Bertelsen TL et al. Regulation of Ca2+ channels by SNAP-25 via recruitment of syntaxin-1 from plasma membrane clusters. Mol Biol Cell 27:3329-3341 (2016). PubMed: 27605709
- Prigge CL et al. M1 ipRGCs Influence Visual Function through Retrograde Signaling in the Retina. J Neurosci 36:7184-97 (2016). PubMed: 27383593
- Sargoy A et al. Differential calcium signaling mediated by voltage-gated calcium channels in rat retinal ganglion cells and their unmyelinated axons. PLoS One 9:e84507 (2014). PubMed: 24416240
- Vilar B et al. Alleviating pain hypersensitivity through activation of type 4 metabotropic glutamate receptor. J Neurosci 33:18951-65 (2013). PubMed: 24285900
- Tozer AJ et al. Nitric oxide signalling augments neuronal voltage-gated L-type (Ca(v)1) and P/q-type (Ca(v)2.1) channels in the mouse medial nucleus of the trapezoid body. PLoS One 7:e32256 (2012). PubMed: 22389692
- Wang M et al. Acute restraint stress enhances hippocampal endocannabinoid function via glucocorticoid receptor activation. J Psychopharmacol 26:56-70 (2012). PubMed: 21890595