For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/akt2-antibody-4h7-ab175354.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Kinases PKB / AKT
Share by email

Anti-AKT2 antibody [4H7] (ab175354)

  • Datasheet
  • SDS
Submit a review Submit a question References (15)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
  • ChIP - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunoprecipitation - Anti-AKT2 antibody [4H7] (ab175354)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
  • Western blot - Anti-AKT2 antibody [4H7] (ab175354)

Key features and details

  • Mouse monoclonal [4H7] to AKT2
  • Suitable for: ICC/IF, ChIP, IP, IHC-P, WB
  • Reacts with: Mouse, Rat, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Primary
Product image
Anti-PTBP1 antibody [EPR9048(B)] (ab133734)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Primary
Product image
PE Anti-PD-L1 antibody [28-8] (ab209962)

View more associated products

Overview

  • Product name

    Anti-AKT2 antibody [4H7]
    See all AKT2 primary antibodies
  • Description

    Mouse monoclonal [4H7] to AKT2
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, ChIP, IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, African green monkey
    Predicted to work with: Non human primates
  • Immunogen

    Recombinant full length protein corresponding to Human AKT2 aa 1-481. (NP_001617) produced in HEK293T cell.
    Sequence:

    MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWM RAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEE RARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRL PFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPS DAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSI TITPPDRYDSLGLLELDQRTHFPQFSYSASIRE


    Database link: P31751
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • MCF7, HeLa, HepG2, A549, 293T, Jurkat, A431, U2OS, COS7, 3T3 L1 and NRK whole celll lysates; AKT2 transfected U2OS cells; Human Medulla Oblongata tissue; Human Esophageal cancer tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 69% PBS, 30% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    4H7
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Kinases
    • PKB / AKT
    • Cancer
    • Signal transduction
    • Protein phosphorylation
    • Serine/threonine kinases
    • AKT
    • Cardiovascular
    • Atherosclerosis
    • Diabetes associated
    • Cardiovascular
    • Heart
    • Cardiac metabolism
    • Metabolism
    • Types of disease
    • Diabetes
    • Metabolism
    • Types of disease
    • Heart disease

Associated products

  • ChIP Related Products

    • ChIP Kit (ab500)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • Hep G2 whole cell lysate (ab166833)
    • MCF7 whole cell lysate (ab29537)
    • HeLa whole cell lysate (ab29545)
    • Jurkat whole cell lysate (ab30128)
    • Jurkat whole cell lysate (ab7899)
    • A-431 whole cell lysate (ab7909)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant human AKT2 protein (ab79798)
  • Related Products

    • Recombinant Human AKT2 protein (ab126930)
    • Recombinant human AKT2 protein (ab60322)
    • Recombinant human AKT2 protein (ab79798)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab175354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF
1/10 - 1/100.
ChIP
Use at an assay dependent concentration.
IP
Use at an assay dependent concentration.

Use 2µg.

IHC-P
1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB
1/1000. Predicted molecular weight: 55 kDa.
Notes
ICC/IF
1/10 - 1/100.
ChIP
Use at an assay dependent concentration.
IP
Use at an assay dependent concentration.

Use 2µg.

IHC-P
1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB
1/1000. Predicted molecular weight: 55 kDa.

Target

  • Function

    General protein kinase capable of phosphorylating several known proteins.
  • Tissue specificity

    Expressed in all human cell types so far analyzed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylation on Thr-309 and Ser-474 is required for full activity.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT2 ubiquitination. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Target information above from: UniProt accession P31751 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 208 Human
    • Entrez Gene: 11652 Mouse
    • Entrez Gene: 25233 Rat
    • Omim: 164731 Human
    • SwissProt: P31751 Human
    • SwissProt: Q60823 Mouse
    • SwissProt: P47197 Rat
    • Unigene: 631535 Human
    • Unigene: 177194 Mouse
    • Unigene: 87066 Rat
    see all
  • Alternative names

    • AKT antibody
    • Akt2 antibody
    • AKT2_HUMAN antibody
    • HIHGHH antibody
    • Murine thymoma viral (v-akt) homolog 2 antibody
    • murine thymoma viral (v-akt) homolog-2 antibody
    • Oncogene AKT2 protein kinase B beta antibody
    • PKB antibody
    • PKB beta antibody
    • PKBB antibody
    • PKBBETA antibody
    • PRKBB antibody
    • Protein kinase Akt 2 antibody
    • Protein kinase Akt-2 antibody
    • Protein kinase B beta antibody
    • RAC beta antibody
    • rac protein kinase beta antibody
    • RAC-BETA antibody
    • RAC-beta serine/threonine-protein kinase antibody
    • RAC-PK-beta antibody
    • RACbeta antibody
    • v akt murine thymoma viral oncogene homolog 2 antibody
    • V-AKT murine thymoma viral oncogene homolog 2 antibody
    see all

Images

  • Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution

    Lane 1 : MCF7 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HepG2 whole cell lysate
    Lane 4 : A549 whole cell lysate
    Lane 5 : 293T whole cell lysate
    Lane 6 : Jurkat whole cell lysate
    Lane 7 : A431 whole cell lysate
    Lane 8 : U2OS whole cell lysate
    Lane 9 : COS7 whole cell lysate
    Lane 10 : 3T3 L1 whole cell lysate
    Lane 11 : NRK whole cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Developed using the ECL technique.

    Predicted band size: 55 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of C2C12 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of Hela cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of MCF-7 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • ChIP - Anti-AKT2 antibody [4H7] (ab175354)
    ChIP - Anti-AKT2 antibody [4H7] (ab175354)

    Chromatin immunoprecipitation analysis of Akt1 and Akt2 was performed using cross-linked chromatin from 1 x 106 HCT116 colon carcinoma cells treated with serum for 0, 15, 30, and 60 minutes. Immunoprecipitation was performed with 1.0ul/100ul well volume of an Atk1 monoclonal antibody  and an Akt2 monoclonal antibody (ab175354). Chromatin aliquots from ~1 x 105 cells were used per ChIP pull-down. Quantitative PCR data were done in quadruplicate using 1ul of eluted DNA in 2ul SYBR real-time PCR reactions containing primers to amplify -15kb upstream of the Egr1 gene or exon-1 of Egr1. PCR calibration curves were generated for each primer pair from a dilution series of sheared total genomic DNA. Quantitation of immunoprecipitated chromatin is presented as signal relative to the total amount of input chromatin. Results represent the mean +/- SEM for three experiments. A schematic representation of the Egr-1 locus is shown above the data where boxes represent exons (black boxes = translated regions, white boxes = untranslated regions); the zigzag line represents an intron; and the straight line represents upstream sequence. Regions amplified by Egr-1 primers are represented by black bars.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)

    Immunohistochemical analysis of deparaffinized Human Esophageal cancer tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate.

  • Immunoprecipitation - Anti-AKT2 antibody [4H7] (ab175354)
    Immunoprecipitation - Anti-AKT2 antibody [4H7] (ab175354)

    Immunoprecipitation of AKT2 was performed on HeLa cells. The antigen:antibody complex was formed by incubating 750 µg whole cell lysate with 2 µg of ab175354. WB detection used ab175354 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)

    Immunohistochemical analysis of deparaffinized normal Human Medulla Oblongata tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate. 

  • Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution

    Lane 1 : Non-transfected U2OS cells
    Lane 2 : U2OS cells transfected with AKT2 siRNA

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Predicted band size: 55 kDa

Protocols

  • ChIP protocols
  • Immunoprecipitation protocols
  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (15)

Publishing research using ab175354? Please let us know so that we can cite the reference in this datasheet.

ab175354 has been referenced in 15 publications.

  • Chen X  et al. LY3023414 inhibits both osteogenesis and osteoclastogenesis through the PI3K/Akt/GSK3 signalling pathway. Bone Joint Res 10:237-249 (2021). PubMed: 33789427
  • Wang S  et al. Downregulation of lncRNA MIR181A2HG by high glucose impairs vascular endothelial cell proliferation and migration through the dysregulation of the miRNAs/AKT2 axis. Int J Mol Med 47:N/A (2021). PubMed: 33537821
  • Liu X  et al. Transcription elongation factor A-like 7, regulated by miR-758-3p inhibits the progression of melanoma through decreasing the expression levels of c-Myc and AKT1. Cancer Cell Int 21:43 (2021). PubMed: 33430878
  • Dai X  et al. Restoration of electrical microenvironment enhances bone regeneration under diabetic conditions by modulating macrophage polarization. Bioact Mater 6:2029-2038 (2021). PubMed: 33474514
  • Liu Y  et al. C1222C Deletion in Exon 8 of ABL1 Is Involved in Carcinogenesis and Cell Cycle Control of Colorectal Cancer Through IRS1/PI3K/Akt Pathway. Front Oncol 10:1385 (2020). PubMed: 32850446
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab175354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.