Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Anti-Beta Lactamase antibody [8A5.A10] (ab12251)

Submit a review Q&A (5)References (27)

Key features and details

  • Mouse monoclonal [8A5.A10] to Beta Lactamase
  • Suitable for: ELISA, WB
  • Reacts with: Escherichia coli
  • Isotype: IgG1

Overview

  • Product name

    Anti-Beta Lactamase antibody [8A5.A10]

  • Description

    Mouse monoclonal [8A5.A10] to Beta Lactamase

  • Host species

    Mouse

  • Specificity

    This antibody specifically recognizes TEM type beta lactamases.

  • Tested applications

    Suitable for: ELISA, WBmore details

  • Species reactivity

    Reacts with: Escherichia coli

  • Immunogen

    Recombinant full length protein corresponding to Mouse Beta Lactamase.
    Database link: P62593

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • General notes

    Dilute in PBS or medium which is identical to that used in the assay system.

     This product was changed from ascites to tissue culture supernatant on 19/12/2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab12251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA
Use a concentration of 10 - 20 µg/ml.
WB
Use a concentration of 10 µg/ml. Predicted molecular weight: 31.5 kDa.

(31.5kDa is the molecular weight of the unprocessed precursor.)
Notes
ELISA
Use a concentration of 10 - 20 µg/ml.
WB
Use a concentration of 10 µg/ml. Predicted molecular weight: 31.5 kDa.

(31.5kDa is the molecular weight of the unprocessed precursor.)

Target

  • Relevance

    The beta lactam antibiotics (penicillins and cephalosporins) are the most frequently used antimicrobial agents. All of the beta lactams are structurally related through the presence of a core beta lactam ring. Bacterial resistance to beta lactams continues to increase, primarily due to the production of beta lactamases. Beta lactamases catalyze the hydrolysis of the beta lactam bond, which destroys antibacterial activity. Bacteria that produce TEM type or SHV type beta lactamases have point mutations in structural genes that have extended the substrate specificity of these beta lactamases. As a result, many of the beta lactamase producing Gram negative pathogens have become multidrug resistant.

  • Alternative names

    • AmpA antibody
    • AmpC antibody
    • Cephalosporinase antibody

References (27)

Publishing research using ab12251? Please let us know so that we can cite the reference in this datasheet.

ab12251 has been referenced in 27 publications.

  • Chaoprasid P  et al. Crystal structure of bacterial cytotoxic necrotizing factor CNFY reveals molecular building blocks for intoxication. EMBO J 40:e105202 (2021). PubMed: 33410511
  • Naha A  et al. Deciphering the possible role of ctxB7 allele on higher production of cholera toxin by Haitian variant Vibrio cholerae O1. PLoS Negl Trop Dis 14:e0008128 (2020). PubMed: 32236098
  • Rivas ZP  et al. CexE Is a Coat Protein and Virulence Factor of Diarrheagenic Pathogens. Front Microbiol 11:1374 (2020). PubMed: 32714302
  • Xiong D  et al. Salmonella Coiled-Coil- and TIR-Containing TcpS Evades the Innate Immune System and Subdues Inflammation. Cell Rep 28:804-818.e7 (2019). PubMed: 31315056
  • Singh R  et al. A ß-lactamase-producing plasmid from Neisseria gonorrhoeae carrying a unique 6 bp deletion in blaTEM-1 encoding a truncated 24 kDa TEM-1 penicillinase that hydrolyses ampicillin slowly. J Antimicrob Chemother 74:2904-2912 (2019). PubMed: 31335939
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a question

1-5 of 5 Q&A

Question

Inquiry: Hello, Does these antibodys(ab97678,ab12252,ab12251) be used for the detection of beta lactamase in cow milk, such as Penicillinase ?

I want to used them in AlphaELISA. I plan to couple one Ab on the acceptor beads, and another Ab to donor beads. In the test, two Ab will capture different epitopes of the beta Lactamase. The acceptor beads and donor beads will be dragged together and generate FRET. The emission spectrum will be detected by our device. I am not sure whether your Ab is capable to capture the beta lactamase. Would you give some suggestions?

Read More
Answer

Thank you for your enquiry.

ab12251 and ab12252 were derived from mice that were immunized with the full-length beta lactamse. The immunogen of ab12251 was recombinant TEM-1 beta-lactamase while ab12252 was native Type IV beta-lactamase from Enterobacter cloacae.

The lactamases appear to be well-conserved, and the antibodies ab97678, ab12252 ab12251 are likely to react with a variety of them. They may possibly recognize your sequence but the epitopes they recognize have not been mapped, so we cannot guarantee these antibodies are all recognize different epitopes.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Question

I am interested in the following two products:

1) Ab against Beta-Lactamase (ab12251) and purified Beta-Lactamase protein (ab104926)

Can you confirm that the above mentioned antibody (ab12251) recognized the purified B-Lactamase protein (ab104926). If so, then I would need a formal offer (preferentially in PDF format) to place the order.

Read More
Answer

Thank you for contacting us.

ab12251's immunogen is 5'-His-tagged E.coli TEM-1 beta lactamase therefore this antibody is specific to TEM-1 beta lactamases. I have compared the sequence similarity between TEM-1 beta lactamase and ab104926 and only found 10% sequence similarity so it is unlikely that this antibody will detect this protein.

However, I have found another protein, beta lactamase TEM precursor protein, ab67672 (https://www.abcam.com/ab67672) which has a 99.6% sequence similarity with TEM-1 beta lactamase. Therefore, this protein is likely to be detected by ab12251.

If you would like a proforma for these two products, please let me know and I will be more than happy to do so.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Question

Phone call requesting information on anti-beta lactamase ab97678.

Read More
Answer

Thank you for contacting us on Friday.

As discussed over the phone, ab12251 and ab97678 are both mouse monoclonals against beta-lactamase. Whilst I cannot find any reference of ab97678 being used in detecting beta-galctosidase expressed in Legionalla, we have a reference where ab12251 has been used for this purpose. A link to this reference can be accessed from below:

Zhu W et al. Comprehensive Identification of Protein Substrates of the Dot/Icm Type IV Transporter of Legionella pneumophila. PLoS One 6:e17638 (2011). PubMed: 21408005

There seems to relatively little background produced in this system with this antibody, and the background that is there could probably be improved on by reducing the amount of protein loaded and optimising the blocking and incubation conditions.

As discussed over the phone, if you were to want to try either ab12251 and ab97678 to detect beta-lactamase in your system, you would be eligible forour testing discount system. This is usually only valid where the application or species for which you want to use the antibody for have not been tested (and are therefore not stated on the datasheet). In this case, the sample and application would be covered by the Abpromise and would therefore not be valid for the testing discount. However, as there are no images on the datasheets of either of these antibodies, we would be willing to extend the testing discount scheme to include a reward for providing us with images of the antibodies being used.

This would involve you purchasing ab12251or ab97678. Testing it in western blotting, then sharing the results obtained through an Abreview (including an image of the results). You would then be entitled to a free primary antibody of your choice from our catalogue. The only limitation is that the antibody needs to be tested, the Abreview submitted, and the "free" antibody claimed within 4 months. More information on this offer can be foundfrom the following link:

https://www.abcam.com/collaboratordiscount

If you would be interested in participating in this scheme please do let me know as a discount code needs to be issuedprior to purchasing the antibody to be tested.

I hope this information has been of help. If you require any further information please do not hesitate to contact us again.

Read More

Question

I was wondering if the antibody ab12251 is recognizing a part of this amino acid sequence? MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLN               SGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL               VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFL               HNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLA SRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPD               GKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW  You also list:  ab97678 Anti-Beta Lactamase antibody [8A5.A10] Mouse monoclonal and ab12252. Does these recognize that amino acid sequence shown above? You only list a 500ug amount as options, I would be more interested in 100 pr 200ug antibody for around 150-200euro,  

Read More
Answer

Thank you for contacting us. The lactamases appear to be well-conserved, and the antibodies ab97678 and ab12251 are likely to react with a variety of them. They may possibly recognize your sequence but the epitopes they recognize have not been mapped, so we cannot guarantee this. Regarding the sizes and prices, the 500ug size is the only one available for ab12251, and the 200ug size is the only size available for ab97678. Please do not hesitate to contact us if you need any more advice or information.

Read More

Question

I want to ask if this antibody can recoganize TEM6 type beta lactamase.

Read More
Answer

To the best of our knowledge, this antibody recognizes all TEM-type beta lactamases. Data is limited to our own work with TEM-1 and reports from customers who have worked with various strains of E. coli. To date, we have not been informed by any of our customers of TEM-type beta lactamases that were not recognized by this antibody, but, presumably, not all relevant strains have been investigated. Good luck with your research,

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com