For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/beta-tubulin-antibody-ep1331y-microtubule-marker-ab52901.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Cytoskeleton Microtubules
Share by email
RecombinantRabMAb

Recombinant Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)

  • Datasheet
  • SDS
Reviews (12)Q&A (2)References (38)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
  • Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
  • Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
  • Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)

Key features and details

  • Produced recombinantly (animal-free) for high batch-to-batch consistency and long term security of supply
  • Rabbit monoclonal [EP1331Y] to beta Tubulin - Microtubule Marker
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Rat, Human

Conjugates logo Related conjugates and formulations

Carrier Free

You may also be interested in

Primary
Product image
HRP Anti-alpha Tubulin antibody [EPR13478(B)] - Loading Control (ab185067)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Primary
Product image
Anti-alpha Tubulin antibody [EP1332Y] - BSA and Azide free (ab216650)

View more associated products

Overview

  • Product name

    Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker
    See all beta Tubulin primary antibodies
  • Description

    Rabbit monoclonal [EP1331Y] to beta Tubulin - Microtubule Marker
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Zebrafish
  • Immunogen

    Synthetic peptide within Human beta Tubulin aa 400 to the C-terminus (C terminal). The exact sequence is proprietary.
    Database link: P07437

  • Positive control

    • WB: PC12 and HeLa whole cell lysate (ab150035) and mouse brain, rat brain, mouse spinal cord and rat spinal cord tissue lysates. IHC-P: Human gastric carcinoma. ICC/IF: HeLa cells.
  • General notes

    This product is a recombinant monoclonal antibody, which offers several advantages including:

    • - High batch-to-batch consistency and reproducibility
    • - Improved sensitivity and specificity
    • - Long-term security of supply
    • - Animal-free production
    For more information see here.

    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMAb® patents.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
  • Storage buffer

    pH: 7.20
    Preservative: 0.01% Sodium azide
    Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    EP1331Y
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Cytoskeleton
    • Microtubules
    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microtubules
    • Tubulin
    • Neuroscience
    • Development

Associated products

  • Alternative Versions

    • Anti-beta Tubulin antibody [EP1331Y] - BSA and Azide free (ab247336)
  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Goat Anti-Rabbit IgG H&L (DyLight® 488) preadsorbed (ab96899)
  • Isotype control

    • Rabbit IgG, monoclonal [EPR25A] - Isotype Control (ab172730)
  • Positive Controls

    • HeLa whole cell lysate (ab29545)
  • Recombinant Protein

    • Recombinant Human beta Tubulin protein (ab70187)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab52901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (6)
1/20000. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa).
IHC-P (2)
Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Notes
WB
1/20000. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa).
IHC-P
Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
  • Tissue specificity

    Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
  • Involvement in disease

    Cortical dysplasia, complex, with other brain malformations 6
    Skin creases, congenital symmetric circumferential, 1
  • Sequence similarities

    Belongs to the tubulin family.
  • Domain

    The highly acidic C-terminal region may bind cations such as calcium.
  • Post-translational
    modifications

    Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group (PubMed:26875866). Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed:26875866).
    Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear.
    Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.
  • Cellular localization

    Cytoplasm, cytoskeleton.
  • Target information above from: UniProt accession P07437 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 203068 Human
    • Entrez Gene: 22154 Mouse
    • Entrez Gene: 29214 Rat
    • Entrez Gene: 386701 Zebrafish
    • Omim: 191130 Human
    • SwissProt: P07437 Human
    • SwissProt: P99024 Mouse
    • SwissProt: P69897 Rat
    • Unigene: 636480 Human
    see all
  • Alternative names

    • Beta 4 tubulin antibody
    • Beta 5 tubulin antibody
    • beta Ib tubulin antibody
    • Beta1 tubulin antibody
    • Class I beta tubulin antibody
    • M40 antibody
    • MGC117247 antibody
    • MGC16435 antibody
    • OK/SW cl.56 antibody
    • OK/SWcl.56 antibody
    • TBB5_HUMAN antibody
    • TUBB 1 antibody
    • TUBB 2 antibody
    • TUBB 5 antibody
    • TUBB antibody
    • TUBB1 antibody
    • TUBB2 antibody
    • TUBB5 antibody
    • tubulin beta 1 chain antibody
    • Tubulin beta 2 chain antibody
    • tubulin beta 5 chain antibody
    • Tubulin beta chain antibody
    • Tubulin beta class I antibody
    • tubulin beta polypeptide antibody
    • Tubulin beta-5 chain antibody
    see all

Images

  • Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    All lanes : Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/20000 dilution

    Lane 1 : Brain (Mouse) Tissue Lysate
    Lane 2 : Brain (Rat) Tissue Lysate
    Lane 3 : Spinal Cord (Mouse) Tissue Lysate
    Lane 4 : Spinal Cord (Rat) Tissue Lysate
    Lane 5 : PC12 (Rat adrenal pheochromocytoma cell line) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (Alexa Fluor® 790) (ab175781) at 1/10000 dilution

    Predicted band size: 50 kDa
    Observed band size: 52 kDa why is the actual band size different from the predicted?



    This blot was produced using a 4-12% Bis-tris gel under the MOPS buffer system. The gel was run at 200V for 50 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using Licor blocking buffer before being incubated with ab52901 overnight at 4°C. Antibody binding was detected using ab175781 at a 1:10,000 dilution for 1hr at room temperature and then imaged using the Licor Odyssey CLx.

  • Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/20000 dilution + HeLa cell lysate at 10 µg

    Secondary
    Goat anti-rabbit HRP-conjugated at 1/2000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)

    ab52901 at 1/250 dilution staining beta Tubulin in human gastric carcinoma by Immunohistochemsitry, Paraffin embedded tissue.

    Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Western blot - Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)This image is courtesy of an anonymous Abreview
    Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/1000 dilution (in PBS +0.5% Tween20 for 2 hours at 23°C) + 293 human embryonic kidney whole cell lysate at 25 µg

    Secondary
    An HRP-conjugated Goat anti-rabbit IgG polyclonal at 1/10000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 50 kDa
    Observed band size: 55 kDa why is the actual band size different from the predicted?


    Exposure time: 45 seconds


    Blocking Step: 5% Milk for 1 hour at 23°C

    See Abreview

  • Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)
    Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (38)

Publishing research using ab52901? Please let us know so that we can cite the reference in this datasheet.

ab52901 has been referenced in 38 publications.

  • Okawa ER  et al. Essential roles of insulin and IGF-1 receptors during embryonic lineage development. Mol Metab 47:101164 (2021). PubMed: 33453419
  • Eisa A  et al. The protein YWHAE (14-3-3 epsilon) in spermatozoa is essential for male fertility. Andrology 9:312-328 (2021). PubMed: 32657535
  • Yang T  et al. Enolase 1 regulates stem cell-like properties in gastric cancer cells by stimulating glycolysis. Cell Death Dis 11:870 (2020). PubMed: 33067426
  • Chang B  et al. Nanofibrous Tubular Three-Dimensional Platform for Single Dental Pulp Stem Cell Polarization. ACS Appl Mater Interfaces 12:54481-54488 (2020). PubMed: 33252216
  • Van der Perren A  et al. The structural differences between patient-derived a-synuclein strains dictate characteristics of Parkinson's disease, multiple system atrophy and dementia with Lewy bodies. Acta Neuropathol 139:977-1000 (2020). PubMed: 32356200
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-10 of 14 Abreviews or Q&A

Western blot abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Mouse Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 11 2019

Western blot abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Rat Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 11 2019

Western blot abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Monkey Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 11 2019

Western blot abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Human Cell lysate - whole cell (HEK293)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
HEK293
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 11 2019

Immunocytochemistry/ Immunofluorescence abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Excellent
Abreviews
Abreviews
abreview image
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (induced Neuron)
Specification
induced Neuron
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Paraformaldehyde
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Dec 16 2015

Immunocytochemistry/ Immunofluorescence abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Excellent
Abreviews
Abreviews
abreview image
Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (Cryopreserved embryonic cortical neurons (QBMcells)
Permeabilization
No
Specification
Cryopreserved embryonic cortical neurons (QBMcells
Fixative
paraformaldehyde with picric acid
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Ms. Babben Tinner

Verified customer

Submitted Feb 26 2015

Immunohistochemistry (Frozen sections) abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Excellent
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Frozen sections)
Sample
Zebrafish Tissue sections (Retina, Inner plexiform layer, ganglion cell)
Permeabilization
Yes - Triton X
Specification
Retina, Inner plexiform layer, ganglion cell
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Paraformaldehyde
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

DR. Ryan Macdonald

Verified customer

Submitted Aug 22 2014

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker

Good
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (skin tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mm Sodium Citrate PH 6.0
Permeabilization
No
Specification
skin tumor
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Fixative
Paraformaldehyde
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Feb 12 2013

Question

Thank you for your reply. Are you able to tell me what epitope this antibody was raised against? I presumme its a section of amino acids in the C-terminal tail given its specific fo beta III. Im just abit confused with when you said the immunogen shares 100% identity with tubulin beta-2C and tubulin beta-3 chains as its called an anti-Beta III tubulin antibody.

Read More

Abcam community

Verified customer

Asked on Sep 19 2011

Answer

Thank you for contacting us. The exact epitope is proprietary information, however I can confirm that it is a synthetic peptide from within the following region corresponding to C terminal amino acids 400-430 of Human beta III Tubulin: EGMDEMEFTEAESNMNDLVSEYQQYQDATA I have performed a BLAST and this region show similarity to other beta-tubulin antibodies therefore it is likely to cross-react. Please do not hesitate to contact me should you have further questions.

Read More

Abcam Scientific Support

Answered on Sep 19 2011

Question

Hi there, im enquiring about abcam antibody Anti-beta III Tubulin antibody [EP1331Y] (ab52901). Firstly it says it has been successfully used in IP can you please confirm this as previously i have used antibodies in ordered from abcam that claim this and they have not worked and i have later found out that they were never tested! (this is not an issue as i got a refund etc i just want to ensure this one is going to work!). Secondly are you aware of any cross reactivity this antibody may have with other beta tubulin isotypes? it says the immunogen is corresponding to residues near the c-terminus. Thanks very much! jessica field

Read More

Abcam community

Verified customer

Asked on Sep 15 2011

Answer

thank you for your enquiry. I understand you concerns and it is regrettable you have previously experienced an error on another datasheet. This is unusual and we endevour to ensure that all the information we have on our datasheets and from our sources is correct. I can confirm that ab52901 Anti-beta III Tubulin antibody [EP1331Y] has been tested in IP. It will be covered by our guarantee for this application. If it does not work in IP we will be able to provide a refund, free of charge replacement or credit note if we are contacted within 6 months of purchase. I am sorry the cross-reactivity with any other beta tubulin isoforms has not specifically been tested in the laboratory. The immunogen shares 100% identity with tubulin beta-2C chain and tubulin beta-3 chain, so it is predicted to cross-react with other isoforms. I hope this information is helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More

Abcam Scientific Support

Answered on Sep 15 2011

1-10 of 14 Abreviews or Q&A

  •  Previous
  • 1
  • 2
  • Next 

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.