For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/carbonic-anhydrase-9ca9-antibody-ab15086.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Hypoxia Associated Proteins
Share by email

Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)

  • Datasheet
  • SDS
Reviews (4)Q&A (8)References (134)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
  • Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
  • Immunohistochemistry (Frozen sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
  • Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)

Key features and details

  • Rabbit polyclonal to Carbonic Anhydrase 9/CA9
  • Suitable for: Flow Cyt (Intra), ICC, IHC-Fr, IHC-P, WB
  • Reacts with: Rat, Human
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-Carbonic Anhydrase 9/CA9 antibody [EPR4151(2)] (ab108351)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-Carbonic Anhydrase 9/CA9 antibody
    See all Carbonic Anhydrase 9/CA9 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 9/CA9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt (Intra), ICC, IHC-Fr, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Carbonic Anhydrase 9/CA9 aa 359-459.
    Sequence:

    LSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNS CLAAGDILALVFGLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETG A


    Database link: Q16790
    (Peptide available as ab109840)
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Ramos, A549, HeLa and MDA-MB-231 cell lysates; Rat renal cortex lysate. Intr Flow Cyt: A-431 and U-87 MG cells. ICC: A-431 cells. IHC-Fr: Human renal cell cancer tumor sections. IHC-P: Human breast cancer sections.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.1% Sodium azide
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Hypoxia
    • Associated Proteins
    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Cancer
    • Cancer Metabolism
    • Response to hypoxia
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia
    • Metabolism
    • Types of disease
    • Cancer

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Immunizing Peptide (Blocking)

    • Recombinant Human RND1 protein (ab109840)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab15086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt (Intra)
1/1000.
ICC
Use a concentration of 2 - 5 µg/ml.
IHC-Fr (1)
1/200 - 1/500.
IHC-P (2)
1/200 - 1/500.
WB (1)
Use a concentration of 1 µg/ml. Detects a band of approximately 55 kDa (predicted molecular weight: 49.7 kDa).Can be blocked with Recombinant Human RND1 protein (ab109840).
Notes
Flow Cyt (Intra)
1/1000.
ICC
Use a concentration of 2 - 5 µg/ml.
IHC-Fr
1/200 - 1/500.
IHC-P
1/200 - 1/500.
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 55 kDa (predicted molecular weight: 49.7 kDa).Can be blocked with Recombinant Human RND1 protein (ab109840).

Target

  • Function

    Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
  • Tissue specificity

    Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Post-translational
    modifications

    Asn-346 bears high-mannose type glycan structures.
  • Cellular localization

    Nucleus. Nucleus, nucleolus. Cell membrane. Cell projection, microvillus membrane. Found on the surface microvilli and in the nucleus, particularly in nucleolus.
  • Target information above from: UniProt accession Q16790 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 768 Human
    • Entrez Gene: 313495 Rat
    • Omim: 603179 Human
    • SwissProt: Q16790 Human
    • Unigene: 63287 Human
    • Alternative names

      • CA-IX antibody
      • CA9 antibody
      • CAH9_HUMAN antibody
      • CAIX antibody
      • Carbonate dehydratase IX antibody
      • Carbonic anhydrase 9 antibody
      • Carbonic anhydrase IX antibody
      • Carbonic dehydratase antibody
      • G250 antibody
      • Membrane antigen MN antibody
      • MN antibody
      • P54/58N antibody
      • pMW1 antibody
      • RCC associated protein G250 antibody
      • RCC-associated antigen G250 antibody
      • Renal cell carcinoma-associated antigen G250 antibody
      see all

    Images

    • Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Western blot analysis labeling Carbonic Anhydrase 9/CA9 with ab15086 at 1 ug/ml in rat renal cortex lysate.
    • Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Western blot analysis labeling Carbonic Anhydrase 9/CA9 with ab15086 at 1 ug/ml in 1) HeLa, 2) MDA-MB-231, and 3) A549 whole cell lysates.
    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Immunohistochemistry analysis of a formalin-fixed, paraffin-embedded tissue section of human breast cancer using ab15086 at 1:1000 dilution. The primary antibody bound to Carbonic Anydrase 9/CA9 antigens in the tissue section was detected using a HRP labeled secondary antibody and DAB reagent. Nuclei of the cells were counterstained with hematoxylin. This antibody generated an expected cytoplasmic staining of Carbonic Anydrase 9/CA9 protein with an intense signal around the cellular membranes in tumor cores. The latter are more likely to be hypoxic in growing tumors which signifies that the observed Carbonic Anydrase 9/CA9 staining is specific.
    • Immunohistochemistry (Frozen sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Immunohistochemistry (Frozen sections) - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Immunohistochemistry analysis of human renal cell cancer tumor cryosections stained with ab15086 at a 1/500 dilution (left) or normal rabbit serum (right).
    • Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      Western blot - Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086)
      All lanes : Anti-Carbonic Anhydrase 9/CA9 antibody (ab15086) at 1 µg/ml

      Lane 1 : Ramos (Human Burkitt's lymphoma cell line) Whole Cell Lysate
      Lane 2 : A549 (Human lung adenocarcinoma epithelial cell line) Whole Cell Lysate

      Lysates/proteins at 10 µg per lane.

      Secondary
      All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

      Predicted band size: 49.7 kDa
      Observed band size: 55 kDa why is the actual band size different from the predicted?

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (134)

    Publishing research using ab15086? Please let us know so that we can cite the reference in this datasheet.

    ab15086 has been referenced in 134 publications.

    • Zatovicova M  et al. ADAM10 mediates shedding of carbonic anhydrase IX ectodomain non‑redundantly to ADAM17. Oncol Rep 49:N/A (2023). PubMed: 36524367
    • Hamon P  et al. TGFβ receptor inhibition unleashes interferon-β production by tumor-associated macrophages and enhances radiotherapy efficacy. J Immunother Cancer 10:N/A (2022). PubMed: 35301235
    • Lu C  et al. Hypoxia-activated neuropeptide Y/Y5 receptor/RhoA pathway triggers chromosomal instability and bone metastasis in Ewing sarcoma. Nat Commun 13:2323 (2022). PubMed: 35484119
    • Gombodorj N  et al. Effects of Ultrafine Single-Nanometer Oxygen Bubbles on Radiation Sensitivity in a Tumor-Bearing Mouse Model. Int J Mol Sci 23:N/A (2022). PubMed: 35743281
    • Takei J  et al. Impact of Neoadjuvant Bevacizumab on Neuroradiographic Response and Histological Findings Related to Tumor Stemness and the Hypoxic Tumor Microenvironment in Glioblastoma: Paired Comparison Between Newly Diagnosed and Recurrent Glioblastomas. Front Oncol 12:898614 (2022). PubMed: 35785200
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunohistochemistry (Frozen sections) abreview for Anti-Carbonic Anhydrase IX antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Frozen sections)
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
    Sample
    Human Tissue sections (Colorectal tumors)
    Specification
    Colorectal tumors
    Permeabilization
    Yes - 1xPBS+0.3%t-X-100
    Fixative
    Formaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Oct 09 2014

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.