Anti-CD14 antibody [1H5D8] (ab181470)
Key features and details
- Mouse monoclonal [1H5D8] to CD14
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CD14 antibody [1H5D8]
See all CD14 primary antibodies -
Description
Mouse monoclonal [1H5D8] to CD14 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
Sequence:TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA
Database link: P08571 -
Positive control
- WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1H5D8 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181470 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
1/200 - 1/1000.
|
|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 40 kDa.
|
Notes |
---|
ICC/IF
1/200 - 1/1000. |
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 40 kDa. |
Target
-
Function
Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. -
Tissue specificity
Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. -
Sequence similarities
Contains 11 LRR (leucine-rich) repeats. -
Post-translational
modificationsN- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 929 Human
- Omim: 158120 Human
- SwissProt: P08571 Human
- Unigene: 163867 Human
-
Alternative names
- CD 14 antibody
- CD_antigen=CD14 antibody
- CD14 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution
Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Predicted band size: 40 kDa -
Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein
Predicted band size: 40 kDaExpected MWt is 46.8 kDa.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (14)
ab181470 has been referenced in 14 publications.
- Zhang PP et al. COVID-19-associated monocytic encephalitis (CAME): histological and proteomic evidence from autopsy. Signal Transduct Target Ther 8:24 (2023). PubMed: 36609561
- Zhai Z et al. Attenuation of Rheumatoid Arthritis Through the Inhibition of Tumor Necrosis Factor-Induced Caspase 3/Gasdermin E-Mediated Pyroptosis. Arthritis Rheumatol 74:427-440 (2022). PubMed: 34480835
- Wang M et al. Renalase and its receptor, PMCA4b, are expressed in the placenta throughout the human gestation. Sci Rep 12:4953 (2022). PubMed: 35322081
- Lee HR et al. CD14+ monocytes and soluble CD14 of synovial fluid are associated with osteoarthritis progression. Arch Rheumatol 37:335-343 (2022). PubMed: 36589618
- Wu M et al. FSTL1 promotes growth and metastasis in gastric cancer by activating AKT related pathway and predicts poor survival. Am J Cancer Res 11:712-728 (2021). PubMed: 33791149