Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)

Reviews (1)Q&A (1)References (7)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
  • Flow Cytometry - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
  • Western blot - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
  • Immunocytochemistry/ Immunofluorescence - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)

Key features and details

  • Mouse monoclonal [9B10D4/4H5E7] to CD34
  • Suitable for: WB, ICC/IF, Flow Cyt, IHC-P
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2b

Overview

  • Product name

    Anti-CD34 antibody [9B10D4/4H5E7]
    See all CD34 primary antibodies

  • Description

    Mouse monoclonal [9B10D4/4H5E7] to CD34

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cyt, IHC-Pmore details

  • Species reactivity

    Reacts with: Human, Recombinant fragment

  • Immunogen

    Recombinant full length protein corresponding to Human CD34.

  • Positive control

    • IF: Peripheral blood cells. WB: CD34 recombinant protein

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR182422-21 are from Tissue Culture Supernatant

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab54208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/200 - 1/1000. Detects a band of approximately 35 kDa (predicted molecular weight: 41 kDa).
ICC/IF (1)
1/100 - 1/500.
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
IHC-P
Use at an assay dependent concentration.
Notes
WB
1/200 - 1/1000. Detects a band of approximately 35 kDa (predicted molecular weight: 41 kDa).
ICC/IF
1/100 - 1/500.
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
IHC-P
Use at an assay dependent concentration.

Target

  • Function

    Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.

  • Tissue specificity

    Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.

  • Sequence similarities

    Belongs to the CD34 family.

  • Developmental stage

    On early hematopoietic progenitor cells.

  • Post-translational
    modifications

    Highly glycosylated.
    Phosphorylated on serine residues by PKC.

  • Cellular localization

    Membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • CD34 antibody
      • CD34 antigen antibody
      • CD34 molecule antibody
      • CD34_HUMAN antibody
      • Cluster designation 34 antibody
      • cluster of differentiation 34 antibody
      • Hematopoietic progenitor cell antigen CD34 antibody
      • HPCA1 antibody
      • Mucosialin antibody
      • OTTHUMP00000034733 antibody
      • OTTHUMP00000034734 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)

      ab54208 at 1/1000 dilution staining CD34 in human spleen tissue sections by Immunohistochemistry (Formalin/ PFA-fixed paraffin-embedded tissue sections). The DAB staining procedure was used for tissue section staining.

    • Flow Cytometry - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Flow Cytometry - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Overlay histogram showing Jurkat cells stained with ab54208 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab54208, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was Alexa Fluor® 488 goat anti-mouse IgG (H+L) (ab150113) at 1/2000 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG ( 1μg/1x106 cells) used under the same conditions. Unlabelled sample (blue line) was also used as a control. Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
    • Western blot - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Western blot - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Anti-CD34 antibody [9B10D4/4H5E7] (ab54208) at 1/200 dilution + Truncated CD34 recombinant protein

      Predicted band size: 41 kDa
      Observed band size: 35 kDa why is the actual band size different from the predicted?

    • Immunocytochemistry/ Immunofluorescence - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Immunocytochemistry/ Immunofluorescence - Anti-CD34 antibody [9B10D4/4H5E7] (ab54208)
      Immunofluorescence analysis of peripheral blood cells using ab54208 (1/100) with FITC-IgG.

    References (7)

    Publishing research using ab54208? Please let us know so that we can cite the reference in this datasheet.

    ab54208 has been referenced in 7 publications.

    • Gorkun AA  et al. The Duo of Osteogenic and Angiogenic Differentiation in ADSC-Derived Spheroids. Front Cell Dev Biol 9:572727 (2021). PubMed: 33898413
    • D'Onofrio N  et al. MicroRNA-33 and SIRT1 influence the coronary thrombus burden in hyperglycemic STEMI patients. J Cell Physiol 235:1438-1452 (2020). PubMed: 31294459
    • Vaidya A  et al. Chimeric feeders of mesenchymal stromal cells and stromal cells modified with constitutively active AKT expand hematopoietic stem cells. Regen Med 14:535-553 (2019). PubMed: 31115264
    • Cao W  et al. Twist1 promotes astrocytoma development by stimulating vasculogenic mimicry. Oncol Lett 18:846-855 (2019). PubMed: 31289562
    • Zhulyn O & Hui CC Sufu and Kif7 in limb patterning and development. Dev Dyn 244:468-78 (2015). PubMed: 25581370
    • Fu S  et al. Telocytes in human liver fibrosis. J Cell Mol Med 19:676-83 (2015). PubMed: 25661250
    • Zhou Q  et al. Cardiac telocytes are double positive for CD34/PDGFR-a. J Cell Mol Med 19:2036-42 (2015). IHC ; Human . PubMed: 26082061

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Immunocytochemistry/ Immunofluorescence abreview for Anti-CD34 antibody [9B10D4]

     Excellent
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (Mel 30)
    Permeabilization
    No
    Specification
    Mel 30
    Blocking step
    Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 20°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    MS. Beate Thode

    Verified customer

    Submitted Feb 20 2013

    Question

    Inquiry: Could you please tell me which CD34 epitope ab54208 is specific to? Thank you.

    Read More
    Answer

    Thank you for your inquiry.
    The immunogen used to generate ab54208 was a Ni-NTA purified truncated human recombinant CD34 expressed in E. Coli strain BL21 with the following sequence:

    MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCA

    The epitope this antibody is binding was not further mapped.
    I hope this information is helpful and wish you good luck with your experiments.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com