For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/cyclin-d3ccnd3-antibody-dcs22-ab28283.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cyclins
Share by email
Validated using a knockout cell line

Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

  • Datasheet
Submit a review Q&A (1)References (28)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
  • Flow Cytometry - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

Key features and details

  • Mouse monoclonal [DCS2.2] to Cyclin D3/CCND3
  • Suitable for: Flow Cyt, WB, IHC-P
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human Cyclin D3/CCND3 protein (ab158041)
Primary
Product image
Anti-Cdk4 antibody [EPR17525] (ab199728)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-Cyclin D3/CCND3 antibody [DCS2.2]
    See all Cyclin D3/CCND3 primary antibodies
  • Description

    Mouse monoclonal [DCS2.2] to Cyclin D3/CCND3
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human Cyclin D3/CCND3.
    Sequence:

    MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQR EIKPHMRKML AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQ LQLLGAVCMLLASKLRETTPLT IEKLCIYTDHAVSPRQLRDWEVLVLG KLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK HAQTFLALCATDYT FAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL RA CQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL


    Database link: P30281
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa, K562, HAP1, HEK-293T and Jurkat cell lysates. Flow Cyt: HeLa cells. IHC-P: Human pancreas tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    DCS2.2
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cyclins
    • Cell Biology
    • Cell Cycle
    • Cyclins
    • Cyclin D Family
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Cyclins
    • Cyclin D Family
    • Cancer
    • Cell cycle
    • Cyclins
    • Cyclin D family

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
  • Positive Controls

    • Jurkat whole cell lysate (ab7899)
    • K-562 whole cell lysate (ab7911)
  • Recombinant Protein

    • Recombinant Human Cyclin D3/CCND3 protein (ab158041)
  • Related Products

    • Recombinant Human Cyclin D3/CCND3 protein (ab158041)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab28283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt
Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

WB
Use at an assay dependent concentration. Predicted molecular weight: 35 kDa.
IHC-P
Use at an assay dependent concentration.
Notes
Flow Cyt
Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

WB
Use at an assay dependent concentration. Predicted molecular weight: 35 kDa.
IHC-P
Use at an assay dependent concentration.

Target

  • Function

    Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin D subfamily.
    Contains 1 cyclin N-terminal domain.
  • Cellular localization

    Nucleus. Cytoplasm. Membrane. Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members.
  • Target information above from: UniProt accession P30281 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 896 Human
    • Entrez Gene: 12445 Mouse
    • Entrez Gene: 25193 Rat
    • Omim: 123834 Human
    • SwissProt: P30281 Human
    • SwissProt: P30282 Mouse
    • SwissProt: P48961 Rat
    • Unigene: 534307 Human
    • Unigene: 27291 Mouse
    • Unigene: 472101 Mouse
    • Unigene: 3483 Rat
    • Unigene: 54319 Rat
    see all
  • Alternative names

    • CCND 3 antibody
    • Ccnd3 antibody
    • CCND3_HUMAN antibody
    • CyclinD3 antibody
    • D3 type cyclin antibody
    • G1 S specific cyclin D3 antibody
    • G1/S specific cyclin D3 antibody
    • G1/S-specific cyclin-D3 antibody
    see all

Images

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    All lanes : Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283) at 1/1000 dilution

    Lane 1 : Wild-type HeLa cell lysate
    Lane 2 : CCND3 knockout HeLa cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : HEK-293 cell lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) at 1/10000 dilution

    Predicted band size: 35 kDa
    Observed band size: 35 kDa



    Lanes 1-4: Merged signal (red and green). Green - ab28283 observed at 35 kDa. Red - loading control ab52901.

     ab28283 Anti-Cyclin D3/CCND3 antibody [DCS2.2]  was shown to specifically react with Cyclin D3 in wild-type HeLa cells. Loss of signal was observed when knockout cell line ab264931 (knockout cell lysate ab257876) was used. Wild-type and Cyclin D3 knockout samples were subjected to SDS-PAGE. ab28283 and Anti-beta Tubulin [EP1331Y] - Microtubule Marker (ab52901) were incubated at room temperature for 2.5 hours at 1 in 1000 dilution and 1 in 20000 dilution respectively. Blots were developed with Goat anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) and Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) secondary antibodies at 1 in 20000 dilution for 1 hour at room temperature before imaging.

  • Flow Cytometry - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Flow Cytometry - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    Overlay histogram showing HeLa cells stained with ab28283 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab28283, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was a goat anti-mouse DyLight® 488 (IgG; H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    ab28283 (4µg/ml) staining Cyclin D3/CCND3 in human pancreas, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong nuclear staining.
    Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer citrate pH6.1 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    Lane 1: Wild-type HAP1 whole cell lysate (20 µg)
    Lane 2: Cyclin D3/CCND3 (KO) knockout HAP1 whole cell lysate (20 µg)
    Lane 3: HEK293 whole cell lysate (20 µg)
    Lane 4: Jurkat whole cell lysate (20 µg)
    Lanes 1 - 4: Merged signal (red and green). Green - ab28283 observed at 33 kDa. Red - loading control, ab176560, observed at 50 kDa.

    ab28283 was shown to specifically recognize CCND3 in wild-type HAP1 cells along with additional cross reactive bands. No bands was observed when CCND3 knockout samples were uexamined. Wild-type and CCND3 knockout samples were subjected to SDS-PAGE. Ab28283 and ab176560 (Rabbit anti alpha Tubulin loading control) were incubated overnight at 4°C at 1 ug/ml and 1/10,000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20,000 dilution for 1 hour at room temperature before imaging.

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    All lanes : Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Nuclear Lysate
    Lane 2 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 3 : K562 (Human erythromyeloblastoid leukemia cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat polyclonal to Mouse IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 35 kDa
    Observed band size: 35 kDa
    Additional bands at: 75 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 8 minutes

Protocols

  • Flow cytometry protocols
  • Immunohistochemistry protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (28)

Publishing research using ab28283? Please let us know so that we can cite the reference in this datasheet.

ab28283 has been referenced in 28 publications.

  • Todorovic Z  et al. Shikonin Derivatives from Onsoma visianii Decrease Expression of Phosphorylated STAT3 in Leukemia Cells and Exert Antitumor Activity. Nutrients 13:N/A (2021). PubMed: 33807148
  • Xiong Y  et al. Circulating Exosomal miR-20b-5p Inhibition Restores Wnt9b Signaling and Reverses Diabetes-Associated Impaired Wound Healing. Small 16:e1904044 (2020). PubMed: 31867895
  • Zhang W  et al. lncRNA MIAT promotes cell invasion and migration in esophageal cancer. Exp Ther Med 19:3267-3274 (2020). PubMed: 32266022
  • Wu H  et al. miR-138-5p suppresses glioblastoma cell viability and leads to cell cycle arrest by targeting cyclin D3. Oncol Lett 20:264 (2020). PubMed: 32989398
  • Stein L  et al. Immunophenotypic Characterization of Canine Splenic Follicular-Derived B-Cell Lymphoma. Vet Pathol 56:350-357 (2019). PubMed: 30636524
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question

Hi!
I ordered:
ab28283 Mouse monoclonal [DCS22] to Cyclin D3
I would like to inform you that the vial contained less antibody than it
was supposed to. It was supposed to contain 100 µg at 1mg/ml, but the
vial only contained 95 µl.
Best regards

Read More

Abcam community

Verified customer

Asked on Oct 25 2012

Answer

Thank you for contacting us and I am sorry for the inconveniences.

Due to the small difference in volume observed, it may well be the remaining antibody amount is stuck at the top of the vial, or even through the sides of the vial as a film viscous liquid. I would recommend centrifuging the vial to make sure it contains all the volume.

In case the volume does not rise, please do not hesitate to contact me again.

Read More

Abcam Scientific Support

Answered on Oct 25 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.