Anti-GPRC5A antibody (ab155557)
Key features and details
- Rabbit polyclonal to GPRC5A
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPRC5A antibody
See all GPRC5A primary antibodies -
Description
Rabbit polyclonal to GPRC5A -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide corresponding to Human GPRC5A aa 1-45 (N terminal).
Sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAF
Database link: Q8NFJ5 -
Positive control
- 293T, A431, H1299, HeLa, HepG2, Molt-4 and Raji cell lysates; CAL27 xenograft tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab155557 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB |
1/500 - 1/3000. Predicted molecular weight: 40 kDa.
|
|
| IHC-P |
1/100 - 1/1000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol using 10mM Citrate buffer (pH6.0) or Tris-EDTA buffer (pH8.0).
|
| Notes |
|---|
|
WB
1/500 - 1/3000. Predicted molecular weight: 40 kDa. |
|
IHC-P
1/100 - 1/1000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol using 10mM Citrate buffer (pH6.0) or Tris-EDTA buffer (pH8.0). |
Target
-
Function
Unknown. This G-protein coupled receptor could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. The comparable expression level in fetal lung and kidney with adult tissues suggests a possible role in embryonic development and maturation of these organs. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. -
Tissue specificity
Expressed at high level in fetal and adult lung tissues. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to PubMed:10783259, expressed at low but detectable level in pancreas and heart. -
Sequence similarities
Belongs to the G-protein coupled receptor 3 family. -
Cellular localization
Cell membrane. Cytoplasmic vesicle membrane. Localized in the plasma membrane and perinuclear vesicles. - Information by UniProt
-
Database links
- Entrez Gene: 9052 Human
- Omim: 604138 Human
- SwissProt: Q8NFJ5 Human
- Unigene: 631733 Human
-
Alternative names
- G protein coupled receptor family C group 5 member A antibody
- G-protein coupled receptor family C group 5 member A antibody
- GPCR 5A antibody
see all
Images
-
Western blot - Anti-GPRC5A antibody (ab155557)All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Lysates/proteins at 30 µg per lane.
Secondary
All lanes : HRP-conjugated anti-rabbit IgG antibody
Predicted band size: 40 kDa -
Western blot - Anti-GPRC5A antibody (ab155557)All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution
Lane 1 : H1299 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 40 kDa
10% SDS PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPRC5A antibody (ab155557)Immunohistochemical analysis of paraffin-embedded Human CAL27 xenograft tissue labeling GPRC5A with ab155557 at 1/100 dilution.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab155557 has been referenced in 2 publications.
- Mi L et al. Circ_0000144 functions as a miR-623 sponge to enhance gastric cancer progression via up-regulating GPRC5A. Biosci Rep 40:N/A (2020). PubMed: 32766708
- Lee CH et al. Discovery of a diagnostic biomarker for colon cancer through proteomic profiling of small extracellular vesicles. BMC Cancer 18:1058 (2018). PubMed: 30382917