For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/neun-antibody-1b7-neuronal-marker-ab104224.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neuron marker Soma marker
Share by email

Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

  • Datasheet
  • SDS
Reviews (27) Submit a question References (331)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Western blot - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

Key features and details

  • Mouse monoclonal [1B7] to NeuN - Neuronal Marker
  • Suitable for: IHC-P, WB, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG2b

You may also be interested in

Primary
Product image
Anti-HuB+HuC+HuD antibody [16A11C1D4] (ab176106)
Primary
Product image
Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab177487)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-NeuN antibody [1B7] - Neuronal Marker
    See all NeuN primary antibodies
  • Description

    Mouse monoclonal [1B7] to NeuN - Neuronal Marker
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NeuN aa 1-100 (N terminal). Expressed in and purified from E. coli.
    Sequence:

    MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTP AQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR


    Database link: Q8BIF2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Rat brain tissue. Mouse cerebellum tissue. Human hippocampus tissue. ICC: Rat brain neural cultures. Primary mouse neurons/glia, DIV14 cells. WB: Adult mouse and rat whole brain lysate.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.03% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    1B7
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Soma marker
    • Tags & Cell Markers
    • Cell Type Markers
    • Neuroscience Markers
    • Neuronal
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Forkhead Box
    • Other FOXes
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Related Products

    • Prestained Protein Ladder – Broad molecular weight (10-245 kDa) (ab116028)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab104224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P (12)
Use a concentration of 5 µg/ml.
WB (2)
1/1000 - 1/2000. Predicted molecular weight: 46, 48 kDa.
ICC/IF (4)
Use a concentration of 1 µg/ml.
Notes
IHC-P
Use a concentration of 5 µg/ml.
WB
1/1000 - 1/2000. Predicted molecular weight: 46, 48 kDa.
ICC/IF
Use a concentration of 1 µg/ml.

Target

  • Function

    RNA-binding protein that regulates alternative splicing events.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Target information above from: UniProt accession A6NFN3 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 146713 Human
    • Entrez Gene: 52897 Mouse
    • Entrez Gene: 287847 Rat
    • SwissProt: A6NFN3 Human
    • SwissProt: Q8BIF2 Mouse
    • Unigene: 135229 Human
    • Unigene: 341103 Mouse
    • Alternative names

      • FLJ56884 antibody
      • FLJ58356 antibody
      • Fox-1 homolog C antibody
      • fox1 homolog C antibody
      • Fox3 antibody
      • FOX3NeuN antibody
      • hexaribonucleotide binding protein 3 antibody
      • HRNBP3 antibody
      • NEUN antibody
      • neuronal nuclei antibody
      • Rbfox3 antibody
      • RFOX3_HUMAN antibody
      • RNA binding protein fox-1 homolog 3 antibody
      • RNA binding protein, fox 1 homolog (C. elegans) 3 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      ab104224 staining NeuN - Neuronal Marker in primary hippocampal rat neurons/glia, (obtained from Neuromics, cat. no. PC35101), DIV14. The cells were fixed with 100% methanol (5 min), permeabilized with 0.1% PBS-Triton X-100 for 5 minutes and then blocked with 1% BSA/10% normal goat serum/0.3M glycine in 0.1%PBS-Tween for 1h. The cells were then incubated overnight at 4°C with ab104224 at 0.1µg/ml and ab6046, Rabbit polyclonal to beta Tubulin - Loading Control. Cells were then incubated with ab150117, Goat polyclonal Secondary Antibody to Mouse IgG H&L (Alexa Fluor® 488) preadsorbed at 1/1000 dilution (shown in green) and ab150080, Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (Alexa Fluor® 594) at 1/1000 dilution (shown in pseudocolour red). Nuclear DNA was labelled with DAPI (shown in blue).

      Also suitable in cells fixed with 4% paraformaldehyde (10 min).

      Image was acquired with a high-content analyser (Operetta CLS, Perkin Elmer) and a maximum intensity projection of confocal sections is shown.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      IHC image of NeuN staining in rat brain formalin-fixed paraffin-embedded tissue section, performed on a Leica Bond™ system using the standard protocol F.

      The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 1 µg/ml, for 15 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

       

      For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

       

    • Western blot - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Western blot - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      All lanes : Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224) at 1/1000 dilution

      Lane 2 : Adult rat whole brain lysate
      Lane 3 : Embryonic E20 rat whole brain lysate
      Lane 4 : Adult mouse whole brain lysate

      Predicted band size: 46, 48 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      Rat brain neural cultures stained with ab104224 in pink, with ab4674 (chicken polyclonal to GFAP)  in green and DNA in blue. ab104224 reveals strong nuclear and distal cytoplasmic staining. It does not stain astrocytes and other non-neuronal cells.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      IHC image of NeuN staining in mouse cerebellum formalin-fixed paraffin-embedded tissue section, performed on a Leica Bond™ system using the standard protocol B.

      The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 1 µg/ml, for 15 minutes at room temperature. A goat anti-rabbit biotinylated secondary antibody was used to detect the primary, and visualized using an HRP conjugated ABC system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

       

      For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      Immunofluorescent analysis of rat brain stem co-stained with ab104224 in green, and a chicken pAb to microtubule associated protein 2 (MAP2) in red. Blue is DAPI staining of nuclear DNA.

      Following transcardial perfusion with 4% paraformaldehyde, the brain was post fixed for 24 hours, cut to 45μM, and free-floating sections were stained. The Fox3/NeuN antibody selectively stains nuclei and the proximal cytoplasm of neuronal cells while the MAP2 antibody labels dendrites and overlaps with Fox3/NeuN staining in the perikarya of neurons.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

      IHC image of FOX3/NeuN staining in human normal hippocampus formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F.

      The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 5 µg/ml, for 15 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

      For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (331)

    Publishing research using ab104224? Please let us know so that we can cite the reference in this datasheet.

    ab104224 has been referenced in 331 publications.

    • Li Q  et al. Expression of G9a in Auditory Cortex Is Downregulated in a Rat Model of Age-Related Hearing Loss. J Mol Neurosci 71:409-418 (2021). PubMed: 32671696
    • Xing F  et al. miR-374 improves cerebral ischemia reperfusion injury by targeting Wnt5a. Exp Anim 70:126-136 (2021). PubMed: 33116025
    • Onizawa H  et al. Aicardi-Goutières syndrome-like encephalitis in mutant mice with constitutively active MDA5. Int Immunol 33:225-240 (2021). PubMed: 33165593
    • Tian DD  et al. Antidepressant Effect of Paeoniflorin Is Through Inhibiting Pyroptosis CASP-11/GSDMD Pathway. Mol Neurobiol 58:761-776 (2021). PubMed: 33025508
    • Li Y  et al. Transcriptome profiling of long noncoding RNAs and mRNAs in spinal cord of a rat model of paclitaxel-induced peripheral neuropathy identifies potential mechanisms mediating neuroinflammation and pain. J Neuroinflammation 18:48 (2021). PubMed: 33602238
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-10 of 27 Abreviews or Q&A

    Immunocytochemistry/ Immunofluorescence abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Rabbit Cell (Cortex)
    Permeabilization
    Yes - 1% TritonX-100
    Specification
    Cortex
    Blocking step
    BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Aug 23 2021

    Immunocytochemistry/ Immunofluorescence abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (Neuron stem cell)
    Permeabilization
    Yes - 1% TritonX-100
    Specification
    Neuron stem cell
    Blocking step
    BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Aug 23 2021

    Immunocytochemistry/ Immunofluorescence abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Rat Cell (Cortical neuron)
    Permeabilization
    Yes - 1% TritonX-100
    Specification
    Cortical neuron
    Blocking step
    BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Aug 23 2021

    Immunohistochemistry free floating abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry free floating
    Sample
    Rat Tissue sections (Cerebellum)
    Specification
    Cerebellum
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Mar 26 2021

    Immunohistochemistry free floating abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry free floating
    Sample
    Rat Tissue sections (brain)
    Specification
    brain
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Mar 23 2021

    Immunohistochemistry free floating abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry free floating
    Sample
    Mouse Tissue sections (Brain (Cortex))
    Specification
    Brain (Cortex)
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Feb 25 2021

    Western blot abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (brain)
    Gel Running Conditions
    Reduced Denaturing (10%)
    Loading amount
    50 µg
    Specification
    brain
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Dr. Polina Vishnyakova

    Verified customer

    Submitted Feb 09 2021

    Western blot abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Rat Tissue lysate - whole (Cerebellum)
    Gel Running Conditions
    Reduced Denaturing (4-15%)
    Loading amount
    30 µg
    Specification
    Cerebellum
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Feb 02 2021

    Immunohistochemistry (PFA perfusion fixed frozen sections) abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (PFA perfusion fixed frozen sections)
    Sample
    Mouse Tissue sections (Brain)
    Antigen retrieval step
    None
    Permeabilization
    Yes - PBS 1x, Triton X-100 1%
    Specification
    Brain
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Jan 21 2021

    Immunohistochemistry (PFA perfusion fixed frozen sections) abreview for Anti-NeuN antibody [1B7] - Neuronal Marker

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (PFA perfusion fixed frozen sections)
    Sample
    Rat Tissue sections (Cerebellum)
    Antigen retrieval step
    None
    Permeabilization
    Yes - PBS 1x, Triton X-100 1%
    Specification
    Cerebellum
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Dec 14 2020

    1-10 of 27 Abreviews or Q&A

    •  Previous
    • 1
    • 2
    • 3
    • Next 

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.