Anti-NRF1 antibody [2F9] (ab55744)
![Western blot - Anti-NRF1 antibody [2F9] (ab55744)](https://www.abcam.com/ps/products/55/ab55744/Images/ab55744-69152-anti-nrf1-antibody-western-blot.jpg "Western blot - Anti-NRF1 antibody [2F9] (ab55744)")
Key features and details
- Mouse monoclonal [2F9] to NRF1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-NRF1 antibody [2F9]
See all NRF1 primary antibodies -
Description
Mouse monoclonal [2F9] to NRF1 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human NRF1 aa 201-285.
Sequence:TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTE EQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Database link: Q16656 -
Positive control
- WB: Human skeletal muscle lysate. IHC-P: Human kidney tissue.
-
General notes
This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
2F9 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab55744 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | (3) |
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa.
|
| IHC-P | (1) |
Use at an assay dependent concentration.
|
| Notes |
|---|
|
WB
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa. |
|
IHC-P
Use at an assay dependent concentration. |
Target
-
Function
Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. -
Tissue specificity
Ubiquitously expressed with strongest expression in skeletal muscle. -
Sequence similarities
Belongs to the NRF1/Ewg family. -
Post-translational
modificationsPhosphorylation enhances DNA binding. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 4899 Human
- Omim: 600879 Human
- SwissProt: Q16656 Human
- Unigene: 654363 Human
-
Alternative names
- alpha pal antibody
- alpha palindromic binding protein antibody
- Alpha palindromic-binding protein antibody
see all
Images
-
Western blot - Anti-NRF1 antibody [2F9] (ab55744)Anti-NRF1 antibody [2F9] (ab55744) at 1 µg/ml + Human skeletal muscle lysate
Secondary
Goat Anti-Mouse IgG (H&L)-HRP Conjugate
Predicted band size: 54 kDaThis image was generated using the ascites version of the product.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NRF1 antibody [2F9] (ab55744)](https://www.abcam.com/ps/products/55/ab55744/Images/ab55744-69153-anti-nrf1-antibody-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NRF1 antibody [2F9] (ab55744)NRF1 antibody (ab55744) used in immunohistochemistry at µg/ml on formalin fixed and paraffin embedded human kidney.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
Datasheet download
References (30)
ab55744 has been referenced in 30 publications.
- Chattopadhyay M et al. The portrait of liver cancer is shaped by mitochondrial genetics. Cell Rep 38:110254 (2022). PubMed: 35045282
- Asimi V et al. Hijacking of transcriptional condensates by endogenous retroviruses. Nat Genet 54:1238-1247 (2022). PubMed: 35864192
- Vangrieken P et al. Hypoxia-induced mitochondrial abnormalities in cells of the placenta. PLoS One 16:e0245155 (2021). PubMed: 33434211
- Rovito D et al. Myod1 and GR coordinate myofiber-specific transcriptional enhancers. Nucleic Acids Res 49:4472-4492 (2021). PubMed: 33836079
- Sönmezer C et al. Molecular Co-occupancy Identifies Transcription Factor Binding Cooperativity In Vivo. Mol Cell 81:255-267.e6 (2021). PubMed: 33290745
