Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)](https://www.abcam.com/ps/products/140/ab140307/Images/ab140307-155512-anti-pi-3-kinase-catalytic-subunit-gamma-pi3k-gamma-antibody-oti4g10-immunohistochemistry.jpg "Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)")
Key features and details
- Mouse monoclonal [OTI4G10] to PI 3 Kinase catalytic subunit gamma/PI3K-gamma
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2a
Overview
-
Product name
Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10]
See all PI 3 Kinase catalytic subunit gamma/PI3K-gamma primary antibodies -
Description
Mouse monoclonal [OTI4G10] to PI 3 Kinase catalytic subunit gamma/PI3K-gamma -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey
Predicted to work with: Mouse, Pig
-
Immunogen
Recombinant full length protein corresponding to Human PI 3 Kinase catalytic subunit gamma/PI3K-gamma aa 1-1102. Produced in HEK-293T cells (NP_002640).
Sequence:MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRK CKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY QKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAF QRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHP WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFT KMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTS PKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESP SSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNAD KLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQ LRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLES LEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIK SLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEK CKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRI MESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHND NIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGK KTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKH SA
Database link: P48736 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRYPI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA. IHC-P: Human ovary adenocarcinoma and pancreas tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA.
-
General notes
Clone OTI4G10 (formerly 4G10).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI4G10 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140307 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB |
1/2000. Predicted molecular weight: 126 kDa.
|
|
| IHC-P |
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
| ICC/IF |
1/100.
|
| Notes |
|---|
|
WB
1/2000. Predicted molecular weight: 126 kDa. |
|
IHC-P
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
|
ICC/IF
1/100. |
Target
-
Function
3-phosphorylates the cellular phosphoinositide PtdIns-4,5-biphosphate (PtdIns(4,5)P2) to produce PtdIns-3, 4,5-triiphosphate (PtdIns(3,4,5)P3). Links G-protein coupled receptor activation to the secondary messenger PtdIns(3,4,5)P3 production. -
Tissue specificity
Pancreas, skeletal muscle, liver and heart. -
Pathway
Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis. -
Sequence similarities
Belongs to the PI3/PI4-kinase family.
Contains 1 PI3K/PI4K domain. - Information by UniProt
-
Database links
- Entrez Gene: 5294 Human
- Entrez Gene: 30955 Mouse
- Entrez Gene: 396979 Pig
- GenBank: AF327656 Human
- Omim: 601232 Human
- SwissProt: P48736 Human
- SwissProt: Q9JHG7 Mouse
- SwissProt: O02697 Pig
see all -
Alternative names
- 1 phosphatidylinositol 3 kinase antibody
- 5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma antibody
- 5-bisphosphate 3-kinase catalytic subunit gamma isoform antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)
Paraffin-embedded human ovary adenocarcinoma tissue stained for PI 3 Kinase catalytic subunit gamma/PI3K-gamma using ab140307 at 1/150 dilution in immunohistochemical analysis.
-
![Western blot - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)](https://www.abcam.com/ps/products/140/ab140307/Images/ab140307-155514-anti-pi-3-kinase-catalytic-subunit-gamma-pi3k-gamma-antibody-oti4g10-western-blot.jpg)
Western blot - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)All lanes : Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 126 kDa -
![Immunocytochemistry/ Immunofluorescence - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)](https://www.abcam.com/ps/products/140/ab140307/Images/ab140307-155513-anti-pi-3-kinase-catalytic-subunit-gamma-pi3k-gamma-antibody-oti4g10-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA, labelling PI 3 Kinase catalytic subunit gamma/PI3K-gamma (green) with ab140307 at 1/100 dilution in ICC/IF.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)](https://www.abcam.com/ps/products/140/ab140307/Images/ab140307-155511-anti-pi-3-kinase-catalytic-subunit-gamma-pi3k-gamma-antibody-oti4g10-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)Paraffin-embedded human pancreas tissue stained for PI 3 Kinase catalytic subunit gamma/PI3K-gamma using ab140307 at 1/150 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (25)
ab140307 has been referenced in 25 publications.
- Sun S et al. Roles of the microRNA-338-3p/NOVA1 axis in retinoblastoma. Mol Med Rep 23:N/A (2021). PubMed: 33760207
- Zhou H et al. Microbial Metabolite Sodium Butyrate Attenuates Cartilage Degradation by Restoring Impaired Autophagy and Autophagic Flux in Osteoarthritis Development. Front Pharmacol 12:659597 (2021). PubMed: 33897442
- Wang Y et al. Inhibition of bone morphogenetic protein receptor 2 suppresses pancreatic ductal adenocarcinoma growth by regulating GRB2/PI3K/AKT axis. Ann Transl Med 9:557 (2021). PubMed: 33987255
- Wang S et al. Relationship between long non-coding RNA PCAT-1 expression and gefitinib resistance in non-small-cell lung cancer cells. Respir Res 22:146 (2021). PubMed: 33980216
- Wang Z & Liu C Upregulated hsa_circRNA_100269 inhibits the growth and metastasis of gastric cancer through inactivating PI3K/Akt axis. PLoS One 16:e0250603 (2021). PubMed: 33901239