Anti-RFP antibody (ab28664)

Thank you for your enquiry regarding ab28664 and for taking the time to provide some useful details of the experiments. I am very sorry to hear that you are having problems with this antibody.

I would like to reassure you that our Abpromise applies to your complaint since you purchased this product within the guarantee period. This means that in the event that a product is not functioning in the applications/species cited on the product data sheet (and the problem has been reported within 6 months of purchase) we will happily offer a credit note/refund to the value of the product purchased.

The protocol looks absolutely fine to me. I could offer you either a new vial of ab28664 or an alternative antibody against the same target or a credit note which you can use for future purchase.





Please dolet me know how you wish to proceed with your enquiry. . I look forward to hearing from you soon.

Thank you for contacting us.

To our knowledge, the antibody ab62341 has not been tested for reactivity with mCherry. I suggest trying ab28664, if you only plan to use it for western blotting, because the immunogen sequence, VNGHEFEIEGEGEGR, is 100% conserved in the mCherry sequence at the following URL.

http://www.ncbi.nlm.nih.gov/protein/114794217

This antibody has not been tested for reactivity with mCherry either but we expect it has a higher likelihood of cross-reaction than ab62341, given that the immunogen for ab62341 is full-length RFP (http://www.uniprot.org/uniprot/Q9U6Y8.fasta), which has only 85% identity with full-length mCherry.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Click here (or use the following: https://www.abcam.com/RFP-antibody-ab28664.html).

Thank you for your patience.

Using the Expasy translate tool, I converted the nucleotide sequence you provided to the following protein sequence:

GAGAGAGAGAMSASSEDVITEFMRFKVKMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVT
KGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERIMNFEDGGVVTVTQ
DSSLQDGCFIYKVKLIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKD
GGHYLVEFKSIYKAKKQVQLPGYYYVDSKLDIISHNEDYTIVEQYERTEGRHHLFL

Three of our RFP antibodies were raised against immunogen sequences that are 100% conserved in Redstar2: ab28664, ab40740, and ab41336. While we have not tested these antibodies for detecting Redstar2, it is very likely that they would be suitable for that purpose.

I hope this helps, please let me know if you need any additional information or assistance.

Thank you for contacting us.

We have not validated this antibody for use with RedStar2. If you could provide the amino acid sequence for this protein I will be happy to check the homology with our RFP antibodies to see if we have one that would be likely to cross-react.

Unfortunately, we do not offer free or trial sized samples of any of our products. I am sorry I could not be more helpful, please let me know if you need any additional information or assistance.

Thank you for your inquiry.


The antibody was raised against amino acids 22-36 of the RFP protein, which is made up of a single 231 amino acid polypeptide chain. The lab said that theprotein doesn't exist in any other form,that it is always a monomer.


I hope this information helps. Please contact us with any other questions.

I am very pleased to hear you would like to accept our offer and test ab28664 in ICC/IF. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for ICC/IF and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.
Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.
Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.
The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Thank you for your enquiry. Indeed, we do have a few RFP antibodies available that also recognise mCherry and are suitable for Western blot, as stated on each datasheet: ab28664: Click here (or use the following: https://www.abcam.com/RFP-antibody-ab28664.html). ab105750: Click here (or use the following: https://www.abcam.com/RFP-antibody-ab105750.html). ab109809: Click here (or use the following: https://www.abcam.com/RFP-antibody-RFPH8-ab109809.html). To our knowledge, ab28664 has not been tested in specifically tested for cross-reactivity with mCherry yet. However, the immunogen shares a 100% sequence similarity with mCherry and so it is very likely that it will work. Furthermore, we do not currently have an image of ab105750 or ab109809 showing the detection of mCherry. Therefore, I can offer a discount off a future purchase if you buy one of these antibodies now, test it in Western blot with mCherry and submit feedback to us in the form of an Abreview (including an image). It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and which antibody you would like to test. I will then send a discount code. This code must be issued before purchasing the antibody so please wait for my reply before ordering. 2. Purchase the antibody either by phone, fax, or online (www.abcam.com). 3. Test it in WB with mCherry. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. Regarding the detection of EGFP proteins, I am happy to let you know that most of our GFP antibodies also detect the enhanced GFP. This is also mentioned on each individual datasheet, such as for ab290 (Click here (or use the following: https://www.abcam.com/GFP-antibody-ab290.html).). All of the information we have for each of our products is listed on the online datasheet for your convenience. These are updated as soon as any new information is brought to our attention. Please be reassured that all our products are covered by our Abpromise: We will happily offer Scientific Support in the event that a product is not functioning in the applications and species cited on the product datasheet (and the problem has been reported within 6 months of purchase). If it appears that the antibody is faulty, a replacement, credit or refund will be offered (https://www.abcam.com/Abpromise). I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.