For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/sall4-antibody-6e3-ab57577.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger
Share by email

Anti-Sall4 antibody [6E3] (ab57577)

  • Datasheet
  • SDS
Reviews (4) Submit a question References (33)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
  • Western blot - Anti-Sall4 antibody [6E3] (ab57577)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
  • Flow Cytometry - Anti-Sall4 antibody [6E3] (ab57577)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)

Key features and details

  • Mouse monoclonal [6E3] to Sall4
  • Suitable for: WB, IHC-P, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human Sall4 protein (ab153444)
Primary
Product image
Anti-ALK antibody [5A4] (ab17127)
Primary
Product image
Anti-GATA3 (phospho S308) antibody [EPR18118] (ab186371)

View more associated products

Overview

  • Product name

    Anti-Sall4 antibody [6E3]
    See all Sall4 primary antibodies
  • Description

    Mouse monoclonal [6E3] to Sall4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Sall4 aa 954-1054.
    Sequence:

    PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS


    Database link: Q9UJQ4
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa cell lysate, IHC-P: human testis. Flow Cyt: HeLa cells.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 12th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    6E3
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Stem Cells
    • Embryonic Stem Cells
    • Intracellular
    • Stem Cells
    • Signaling Pathways
    • Wnt
    • Nuclear
    • Developmental Biology
    • Embryogenesis
    • Embryonic stem cells
    • Surface molecules

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
  • Recombinant Protein

    • Recombinant Human Sall4 protein (ab153444)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab57577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
Use at an assay dependent concentration. Predicted molecular weight: 112 kDa.
IHC-P (4)
Use at an assay dependent concentration.
Flow Cyt
Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Notes
WB
Use at an assay dependent concentration. Predicted molecular weight: 112 kDa.
IHC-P
Use at an assay dependent concentration.
Flow Cyt
Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Probable transcription factor.
  • Tissue specificity

    Expressed in testis.
  • Involvement in disease

    Defects in SALL4 are the cause of Duane-radial ray syndrome (DRRS) [MIM:607323]; also known as Okihiro syndrome. DRRS is a disorder characterized by the association of forearm malformations with Duane retraction syndrome.
    Defects in SALL4 are the cause of oculootoradial syndrome (OORS) [MIM:147750]. Oculootoradial syndrome is an autosomal dominant condition characterized by upper limbs anomalies (radial ray defects, carpal bones fusion), extraocular motor disturbances, congenital bilateral non-progressive mixed hearing loss. Other less consistent malformations include heart involvement, mild thrombocytopenia and leukocytosis (before age 50), shoulder girdle hypoplasia, imperforate anus, kidney malrotation or rectovaginal fistula. The IVIC syndrome is an allelic disorder of Duane-radial ray syndrome (DRRS) with a similar phenotype.
  • Sequence similarities

    Belongs to the sal C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession Q9UJQ4 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 57167 Human
    • Omim: 607343 Human
    • SwissProt: Q9UJQ4 Human
    • Unigene: 517113 Human
    • Alternative names

      • AA407717 antibody
      • AL022809 antibody
      • AW536104 antibody
      • C330011P20Rik antibody
      • C78083 antibody
      • C78563 antibody
      • dJ1112F19.1 antibody
      • DRRS antibody
      • HSAL4 antibody
      • Sal like 4 (Drosophila) antibody
      • Sal like 4 antibody
      • Sal like Protein 4 antibody
      • Sal-like protein 4 antibody
      • Sall4 antibody
      • SALL4_HUMAN antibody
      • Spalt like transcription factor 4 antibody
      • Tex20 antibody
      • Zinc finger protein 797 antibody
      • Zinc finger protein SALL4 antibody
      • ZNF797 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)Image from Gassei, Kathrin, et. al. PLoS ONE 8.1 (2013): e53976. doi: 10.1371/journal.pone.0053976. Fig 2A,D. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/

      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of testes from juvenile (PND 7 and PND 14) mice labeling Sall4 with ab57577. Testes were dissected and fixed in 4% PFA overnight at 4°C. Fixed tissues were processed for paraffin embedding and 5 µm serial sections were collected. Sections were deparaffinized in xylene (2×15 min), rehydrated in a graded ethanol series (2×100% for 10 min, 1×95% for 5 min, 1×80% for 5 min, 1×70% for 5 min, 1×50% for 5 min, 1×25% for 5 min) and rinsed in 1× DPBS. Slides were then incubated in sodium citrate antigen retrieval buffer (10 mM Sodium Citrate, 0.05% Tween-20, pH 6) for 30 min at 97.5°C and allowed to cool to room temperature. After rinsing twice in 1× DPBS containing 0.1% Tween-20 (DBPS-T), unspecific binding sites in tissue sections were saturated by incubation with blocking buffer (1× DPBS containing 3% bovine serum albumin, 0.1% Triton X-100 and 5% normal serum from the host species of the secondary antibody) for 30 min at room temperature. Primary antibodies were diluted in blocking buffer and added to tissue sections for 90 min at room temperature.

      This image was generated using the ascites version of the product.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)This image is courtesy of an Abreview from Zachary Yu-Ching Lin.

      IHC-P image of Sall4 staining with ab57577 on tissue sections from adult mouse testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.

      This image was generated using the ascites version of the product.

      See Abreview

    • Western blot - Anti-Sall4 antibody [6E3] (ab57577)
      Western blot - Anti-Sall4 antibody [6E3] (ab57577)

      Sall4 antibody (ab57577) at 1ug/lane + HeLa cell lysate at 25ug/lane.

      This image was generated using the ascites version of the product.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)

      Sall4 antibody (ab57577) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human testis.

      This image was generated using the ascites version of the product.

    • Flow Cytometry - Anti-Sall4 antibody [6E3] (ab57577)
      Flow Cytometry - Anti-Sall4 antibody [6E3] (ab57577)

      Overlay histogram showing HeLa cells stained with ab57577 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57577, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.

      This image was generated using the ascites version of the product.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody [6E3] (ab57577)This image is courtesy of an Abreview from Zachary Yu-Ching Lin.

      IHC-P image of Sall4 staining with ab57577 on tissue sections from adult marmoset testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.

      This image was generated using the ascites version of the product.

      See Abreview

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (33)

    Publishing research using ab57577? Please let us know so that we can cite the reference in this datasheet.

    ab57577 has been referenced in 33 publications.

    • Irie T  et al. IL-34 in hepatoblastoma cells potentially promote tumor progression via autocrine and paracrine mechanisms. Cancer Med 11:1441-1453 (2022). PubMed: 35132816
    • Rodriguez-Polo I  et al. A piggyBac-based platform for genome editing and clonal rhesus macaque iPSC line derivation. Sci Rep 11:15439 (2021). PubMed: 34326359
    • Shimizu N  et al. PLZF and its fusion proteins are pomalidomide-dependent CRBN neosubstrates. Commun Biol 4:1277 (2021). PubMed: 34764413
    • Kong NR  et al. Zinc Finger Protein SALL4 Functions through an AT-Rich Motif to Regulate Gene Expression. Cell Rep 34:108574 (2021). PubMed: 33406418
    • Park HJ  et al. Toxic Effects of Nonylphenol on Neonatal Testicular Development in Mouse Organ Culture. Int J Mol Sci 21:N/A (2020). PubMed: 32429066
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-4 of 4 Abreviews or Q&A

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-Sall4 antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Human Tissue sections (germ cell tumor)
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: citrate, pH6, 100C, 20min
    Permeabilization
    No
    Specification
    germ cell tumor
    Blocking step
    H2O2 as blocking agent for 10 minute(s) · Concentration: 3% · Temperature: 25°C
    Fixative
    Formaldehyde
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Jun 22 2015

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-Sall4 antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Mouse Tissue sections (Adult testis)
    Specification
    Adult testis
    Fixative
    Formaldehyde
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Dako antigen retrieval solution
    Permeabilization
    No
    Blocking step
    Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    DR. 煜欽 林

    Verified customer

    Submitted Mar 25 2013

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-Sall4 antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Marmoset (common) Tissue sections (Adult testis)
    Specification
    Adult testis
    Fixative
    Formaldehyde
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Dako antigen retrieval solution
    Permeabilization
    No
    Blocking step
    Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    DR. 煜欽 林

    Verified customer

    Submitted Mar 16 2013

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-Sall4 antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Rhesus monkey Tissue sections (Testis)
    Specification
    Testis
    Fixative
    Paraformaldehyde
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: 10mM sodium citrate + 0.05% Tween-20
    Permeabilization
    No
    Blocking step
    5% goat serum, 3% BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More
    The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

    Abcam user community

    Verified customer

    Submitted Apr 26 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.