Anti-SCP3 antibody [6F9C5] (ab181746)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

Loading size & price…

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-SCP3 antibody [6F9C5] (ab181746)

Key features and details

Mouse monoclonal [6F9C5] to SCP3
Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
Reacts with: Human, Recombinant fragment
Isotype: IgG1

Product name

Anti-SCP3 antibody [6F9C5]
See all SCP3 primary antibodies
Description

Mouse monoclonal [6F9C5] to SCP3
Host species

Mouse
Tested applications

Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
Species reactivity

Reacts with: Human, Recombinant fragment
Predicted to work with: Cynomolgus monkey
Immunogen

Recombinant fragment corresponding to Human SCP3 aa 27-128. Expressed in E. Coli.
Sequence:
FETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEG VGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYS QQ

Database link: Q8IZU3
Run BLAST with Run BLAST with
Positive control
- SCP3 recombinant protein; SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate; HepG2 cells; Jurkat cells; Human cervical cancer and Human kidney tissues.
General notes

This product was changed from ascites to supernatant. Lot no’s high than GR160891-17 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

Preservative: 0.05% Sodium azide
Constituent: 99% PBS

0.5% protein stabilizer
Concentration information loading...
Purity

Protein G purified
Purification notes

Purified from tissue culture supernatant.
Clonality

Monoclonal
Clone number

6F9C5
Isotype

IgG1
Research areas

Compatible Secondaries
- Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
- Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Isotype control
- Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
IHC-P		1/200 - 1/1000.
WB		1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF		1/200 - 1/1000.
Flow Cyt		1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Function

Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development.
Tissue specificity

Testis-specific.
Involvement in disease

Defects in SYCP3 are a cause of azoospermia due to perturbations of meiosis (AZSPM) [MIM:270960]. AZSPM is a condition of having no sperm present in the ejaculate. Testicular histology shows arrest of spermatogenesis at the pachytene stage of primary spermatocytes.
Sequence similarities

Belongs to the XLR/SYCP3 family.
Cellular localization

Nucleus. In tripartite segments of synaptonemal complexes, irrespective of whether these are synapsed or unsynapsed.
Target information above from: UniProt accession Q8IZU3 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 50511 Human
- Omim: 604759 Human
- SwissProt: Q4R764 Cynomolgus monkey
- SwissProt: Q8IZU3 Human
- Unigene: 506504 Human
Alternative names
- choline phosphotransferase 1 antibody
- chpt1 antibody
- COR 1 antibody
- COR1 antibody
- MGC71888 antibody
- RNASCP3 antibody
- SCP 3 antibody
- SCP-3 antibody
- SCP3 antibody
- SPGF4 antibody
- Sycp 3 antibody
- Sycp3 antibody
- SYCP3_HUMAN antibody
- Synaptonemal complex protein 3 antibody
see all

Immunocytochemistry/ Immunofluorescence - Anti-SCP3 antibody [6F9C5] (ab181746)

Immunofluorescent analysis of HepG2 cells labeling SPC3 with ab181746 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Western blot - Anti-SCP3 antibody [6F9C5] (ab181746)

Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution + SCP3 recombinant protein

Predicted band size: 28 kDa
Western blot - Anti-SCP3 antibody [6F9C5] (ab181746)

All lanes : Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution

Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate

Predicted band size: 28 kDa
Flow Cytometry - Anti-SCP3 antibody [6F9C5] (ab181746)

Flow Cytometrical analysis of Jurkat cells labeling SCP3 with ab181746 at 1/200 (green) compared to a negative control antibody (red).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)

Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling SCP3 with ab181746 at 1/200.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)

Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling SCP3 with ab181746 at 1/200.

Flow cytometry protocols
Immunohistochemistry protocols
Immunocytochemistry & immunofluorescence protocols
Western blot protocols

Click here to view the general protocols

Datasheet download

Download

Publishing research using ab181746? Please let us know so that we can cite the reference in this datasheet.

ab181746 has been referenced in 2 publications.

Wang T et al. MFN2 Deficiency Impairs Mitochondrial Functions and PPAR Pathway During Spermatogenesis and Meiosis in Mice. Front Cell Dev Biol 10:862506 (2022). PubMed: 35493072
Yu X et al. Human amniotic fluid stem cells possess the potential to differentiate into primordial follicle oocytes in vitro. Biol Reprod 90:73 (2014). Human . PubMed: 24571984

Customer reviews and Q&As

Show All Reviews Q&A

Submit a review Submit a question

1-2 of 2 Abreviews or Q&A

Application

Immunocytochemistry/ Immunofluorescence

Sample

Human Cell (human testis cells)

Permeabilization

Yes - triton x100 0.3%

Specification

human testis cells

Blocking step

Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Fixative

Paraformaldehyde

The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

DR. Dai Zhou

Verified customer

Submitted Apr 08 2019

Question

My question is about Anti-SCP3 antibody [6F9C5] (ab181746).

At description of this antibodies is written: Tissue specificity:Testis-specific... Component of the transverse filaments/

(But SCP3 - is the protein of lateral elements of SCs) of synaptonemal complexes (SCs) ... Has an essential meiotic function in spermatogenesis.
May be important for testis development.

But below legend to photo is : Immunofluorescentanalysisof HepG2 cells (liver cells, but not testes) labeling SPC3 with ab181746 at 1/200 (green).

And second Fig.: Immunohistochemistry (Formalin / PFA-fixed paraffin-embedded sections) - Anti-SCP3 [6F9C5] antibody (ab181746)

Immunohistochemical analysis of paraffin embeddedHuman kidney (again, not testes) tissue labeling SCP3 with ab181746 at 1/200.

Please specify/ Are the antibodies ab181746 realy antibodies to the SCP3 - the protein of lateral elements of of synaptonemal complexes ?

Abcam community

Verified customer

Asked on Jul 10 2015

Answer

The information "testis specific" and "Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development," this is information that does not come from Abcam but comes directly from Uniprot: http://www.uniprot.org/uniprot/Q8IZU3

We do however believe that this antibody ab181746 is a good antibody as it does not appear that SYCP3 is expressed in testis only. If you look at the “staining overview” on the protein atlas website http://www.proteinatlas.org/ENSG00000139351-SYCP3/tissue/staining+overview it seems like other antibodies also show positive staining in other tissues as well such as kidney.

Also, I searched for some other sources and it seems that SYCP3 is expressed across various tissues. http://www.genecards.org/cgi-bin/carddisp.pl?gene=SYCP3#expression

Elisa Thomas

Abcam Scientific Support

Answered on Jul 10 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Switch on our new BETA site

Now available

In the coming months

Key features and details

Overview

Product name

Description

Host species

Tested applications

Species reactivity

Immunogen

Positive control

General notes

Properties

Form

Storage instructions

Storage buffer

Purity

Purification notes

Clonality

Clone number

Isotype

Research areas

Associated products

Compatible Secondaries

Isotype control

Applications

The Abpromise guarantee

Target

Function

Tissue specificity

Involvement in disease

Sequence similarities

Cellular localization

Database links

Alternative names

Images

Protocols

Datasheets and documents

Datasheet download

References (2)

Customer reviews and Q&As

Immunocytochemistry/ Immunofluorescence abreview for Anti-SCP3 antibody [6F9C5]