Anti-SCP3 antibody [6F9C5] (ab181746)
Key features and details
- Mouse monoclonal [6F9C5] to SCP3
- Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-SCP3 antibody [6F9C5]
See all SCP3 primary antibodies -
Description
Mouse monoclonal [6F9C5] to SCP3 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human SCP3 aa 27-128. Expressed in E. Coli.
Sequence:FETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEG VGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYS QQ
Database link: Q8IZU3 -
Positive control
- SCP3 recombinant protein; SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate; HepG2 cells; Jurkat cells; Human cervical cancer and Human kidney tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR160891-17 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6F9C5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181746 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 28 kDa.
|
|
ICC/IF |
1/200 - 1/1000.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 28 kDa. |
ICC/IF
1/200 - 1/1000. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development. -
Tissue specificity
Testis-specific. -
Involvement in disease
Defects in SYCP3 are a cause of azoospermia due to perturbations of meiosis (AZSPM) [MIM:270960]. AZSPM is a condition of having no sperm present in the ejaculate. Testicular histology shows arrest of spermatogenesis at the pachytene stage of primary spermatocytes. -
Sequence similarities
Belongs to the XLR/SYCP3 family. -
Cellular localization
Nucleus. In tripartite segments of synaptonemal complexes, irrespective of whether these are synapsed or unsynapsed. - Information by UniProt
-
Database links
- Entrez Gene: 50511 Human
- Omim: 604759 Human
- SwissProt: Q4R764 Cynomolgus monkey
- SwissProt: Q8IZU3 Human
- Unigene: 506504 Human
-
Alternative names
- choline phosphotransferase 1 antibody
- chpt1 antibody
- COR 1 antibody
see all
Images
-
Immunofluorescent analysis of HepG2 cells labeling SPC3 with ab181746 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution + SCP3 recombinant protein
Predicted band size: 28 kDa -
All lanes : Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution
Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 28 kDa -
Flow Cytometrical analysis of Jurkat cells labeling SCP3 with ab181746 at 1/200 (green) compared to a negative control antibody (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)
Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling SCP3 with ab181746 at 1/200.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCP3 antibody [6F9C5] (ab181746)
Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling SCP3 with ab181746 at 1/200.
Protocols
Datasheets and documents
-
Datasheet download
References (2)
ab181746 has been referenced in 2 publications.
- Wang T et al. MFN2 Deficiency Impairs Mitochondrial Functions and PPAR Pathway During Spermatogenesis and Meiosis in Mice. Front Cell Dev Biol 10:862506 (2022). PubMed: 35493072
- Yu X et al. Human amniotic fluid stem cells possess the potential to differentiate into primordial follicle oocytes in vitro. Biol Reprod 90:73 (2014). Human . PubMed: 24571984