Anti-SETD3 antibody (ab176582)
Key features and details
- Rabbit polyclonal to SETD3
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SETD3 antibody -
Description
Rabbit polyclonal to SETD3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis -
Immunogen
Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary.
Sequence:MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY
Database link: Q86TU7 -
Positive control
- Jurkat, HeLa, 293T, mouse TCMK1 and mouse NIH 3T3 whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176582 was affinity purified using an epitope specific to SETD3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176582 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 67 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 67 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Histone methyltransferase that methylates 'Lys-36' of histone H3 (H3K36me). H3 'Lys-36' methylation represents a specific tag for epigenetic transcriptional activation. -
Sequence similarities
Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. SETD3 subfamily.
Contains 1 SET domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 423445 Chicken
- Entrez Gene: 512324 Cow
- Entrez Gene: 490852 Dog
- Entrez Gene: 84193 Human
- Entrez Gene: 52690 Mouse
- Entrez Gene: 100152552 Pig
- Entrez Gene: 299295 Rat
- Entrez Gene: 705369 Rhesus monkey
see all -
Alternative names
- C14orf154 antibody
- Chromosome 14 open reading frame 154 antibody
- DKFZp761E1415 antibody
see all
Images
-
Detection of SETD3 by Western Blot of Immunprecipitate.
Anti-SETD3 antibody at 1µg/ml labeling SETD3 in Jurkat whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176582 at 6µg/mg lysate.Detection: Chemiluminescence with exposure time of 30 seconds.
-
All lanes : Anti-SETD3 antibody (ab176582) at 0.1 µg/ml
Lane 1 : Jurkat whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : 293T whole cell lysate
Lane 4 : Mouse TCMK1 whole cell lysate
Lane 5 : Mouse NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 67 kDa
Exposure time: 1 minute
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab176582 has been referenced in 5 publications.
- Peters CE et al. Structure-function analysis of enterovirus protease 2A in complex with its essential host factor SETD3. Nat Commun 13:5282 (2022). PubMed: 36075902
- Seervai RNH et al. The Huntingtin-interacting protein SETD2/HYPB is an actin lysine methyltransferase. Sci Adv 6:N/A (2020). PubMed: 33008892
- Abaev-Schneiderman E et al. SETD3 is a positive regulator of DNA-damage-induced apoptosis. Cell Death Dis 10:74 (2019). PubMed: 30683849
- Diep J et al. Enterovirus pathogenesis requires the host methyltransferase SETD3. Nat Microbiol 4:2523-2537 (2019). PubMed: 31527793
- Cohn O et al. Chromatin associated SETD3 negatively regulates VEGF expression. Sci Rep 6:37115 (2016). WB ; Human . PubMed: 27845446