For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/primary-antibodies/snail--slug-antibody-ab167609.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neural Stem Cell marker
Share by email

Anti-SNAIL + SLUG antibody (ab167609)

  • Datasheet
Submit a review Submit a question References (19)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-SNAIL + SLUG antibody (ab167609)
  • Immunocytochemistry/ Immunofluorescence - Anti-SNAIL + SLUG antibody (ab167609)
  • Western blot - Anti-SNAIL + SLUG antibody (ab167609)

Key features and details

  • Mouse polyclonal to SNAIL + SLUG
  • Suitable for: WB, ICC/IF
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-SNAIL antibody [EPR21043] (ab216347)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-SNAIL + SLUG antibody
    See all SNAIL + SLUG primary antibodies
  • Description

    Mouse polyclonal to SNAIL + SLUG
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant full length protein aa 1-264. Corresponding to Human SNAIL.
    Sequence:

    MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL NPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGS QPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQA RKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSL LHKHQESGCSGCPR


    Database link: NP_005976.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • SNAIl transfected 293T cell lysate. HeLa cells.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.4
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neural Stem Cell marker
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Transcription factors
    • Cardiovascular
    • Heart
    • Cardiogenesis
    • Transcription factors/regulators
    • Stem Cells
    • Neural Stem Cells
    • Neural Crest Stem Cells
    • Developmental Biology
    • Lineage specification
    • Ectoderm
    • Developmental Biology
    • Organogenesis
    • Nervous system development

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)
  • Related Products

    • Recombinant Human SNAIL protein (ab134870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab167609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
ICC/IF
Use a concentration of 10 µg/ml.
Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
ICC/IF
Use a concentration of 10 µg/ml.

Target

  • Relevance

    Function: SNAIL is involved in the epithelial to mesenchymal transition (EMT) and formation and maintenance of embryonic mesoderm (By similarity). Binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. SLUG is a transcriptional repressor, involved in the generation and migration of neural crest cells. PTM: SNAIL is phosphorylated by GSK3B. Once phosphorylated, it becomes a target for BTRC ubiquitination. Ubiquitinated on Lys-98, Lys-137 and Lys-146 by FBXL14 and BTRC leading to degradation. BTRC-triggered ubiquitination requires previous GSK3B-mediated SNAI1 phosphorylation. Similarity: Both SNAIL and SLUG belong to the snail C2H2-type zinc-finger protein family. Tissue specificity: SNAIL is expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. SLUG is expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle.
  • Cellular localization

    Slug is generally nuclear, while Snail is known to be both cytoplasmic and nuclear. Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) snail is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.
  • Database links

    • Entrez Gene: 6591 Human
    • Entrez Gene: 6615 Human
    • Omim: 604238 Human
    • SwissProt: O43623 Human
    • SwissProt: O95863 Human
    • Alternative names

      • dJ710H13.1 antibody
      • MGC10182 antibody
      • Neural crest transcription factor Slug antibody
      • Protein sna antibody
      • Protein snail homolog 1 antibody
      • Protein snail homolog 2 antibody
      • Protein snail homolog antibody
      • Slug homolog zinc finger protein antibody
      • Slug zinc finger protein antibody
      • SLUGH antibody
      • SLUGH 1 antibody
      • SLUGH1 antibody
      • SLUGH2 antibody
      • SNA antibody
      • Sna protein antibody
      • SNAH antibody
      • SNAI 2 antibody
      • snai1 antibody
      • SNAI1_HUMAN antibody
      • Snai2 antibody
      • SNAI2_HUMAN antibody
      • Snail 2 antibody
      • Snail homolog 1 (Drosophila) antibody
      • Snail homolog 2 antibody
      • Snail2 antibody
      • WS 2D antibody
      • WS2D antibody
      • Zinc finger protein SLUG antibody
      • Zinc finger protein SNAI1 antibody
      • Zinc finger protein SNAI2 antibody
      see all

    Images

    • Western blot - Anti-SNAIL + SLUG antibody (ab167609)
      Western blot - Anti-SNAIL + SLUG antibody (ab167609)
      All lanes : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml

      Lane 1 : SNAIL transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Secondary
      All lanes : Goat anti-Mouse IgG

      Predicted band size: 29 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-SNAIL + SLUG antibody (ab167609)
      Immunocytochemistry/ Immunofluorescence - Anti-SNAIL + SLUG antibody (ab167609)
      Immunofluorescent analysis of HeLa cells labeling SNAIL with ab167609 at 10 µg/ml.
    • Western blot - Anti-SNAIL + SLUG antibody (ab167609)
      Western blot - Anti-SNAIL + SLUG antibody (ab167609)
      Lane 1 : Monoclonal Mouse anti-GST at 1 µg
      Lanes 2 & 5 : Milk at 5 %
      Lane 3 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg
      Lane 4 : Monoclonal Mouse anti-GST at 1 µg/ml
      Lane 6 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml

      Lanes 1-3 : SNAIL-GST fusion protein
      Lanes 4-6 : SLUG-GST-fusion protein

      Lysates/proteins at 0.2 µg per lane.

      Secondary
      All lanes : HRP conjugated Goat anti-mouse at 1/5000 dilution

      Predicted band size: 29 kDa
      Additional bands at: 55.5 kDa (possible tagged protein), 56.4 kDa (possible tagged protein)


      Exposure time: 90 seconds


      Substrate: Perkin Elmer

    Protocols

    • Western blot protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (19)

    Publishing research using ab167609? Please let us know so that we can cite the reference in this datasheet.

    ab167609 has been referenced in 19 publications.

    • Dang L  et al. Downregulation of sperm-associated antigen 5 inhibits melanoma progression by regulating forkhead box protein M1/A disintegrin and metalloproteinase 17/NOTCH1 signaling. Bioengineered 13:4744-4756 (2022). PubMed: 35138218
    • Kang GJ  et al. PRR16/Largen Induces Epithelial-Mesenchymal Transition through the Interaction with ABI2 Leading to the Activation of ABL1 Kinase. Biomol Ther (Seoul) 30:340-347 (2022). PubMed: 35719027
    • Cai S  et al. Reduced kinase D‑interacting substrate of 220 kDa (Kidins220) in pancreatic cancer promotes EGFR/ERK signalling and disease progression. Int J Oncol 58:N/A (2021). PubMed: 33955519
    • He X  et al. Oestrogen induces epithelial-mesenchymal transition in endometriosis via circ_0004712/miR-148a-3p sponge function. J Cell Mol Med 24:9658-9666 (2020). PubMed: 32667746
    • Xiong W  et al. E2 -mediated EMT by activation of ß-catenin/Snail signalling during the development of ovarian endometriosis. J Cell Mol Med 23:8035-8045 (2019). PubMed: 31560827
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab167609.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.