Anti-UBE2E3 antibody [OTI4B4] (ab128098)
Key features and details
- Mouse monoclonal [OTI4B4] to UBE2E3
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt (Intra)
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-UBE2E3 antibody [OTI4B4]
See all UBE2E3 primary antibodies -
Description
Mouse monoclonal [OTI4B4] to UBE2E3 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IF, Flow Cyt (Intra)more details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human UBE2E3 aa 1-207. (NP_006348) produced in E.coli.
Sequence:MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT
Database link: Q969T4 -
Positive control
- WB: HepG2 extracts; HEK-293T cells transiently transfected with the UBE2E3 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF: HepG2 cells. Flow Cyt (Intra): HeLa and Jurkat cells; HEK-293T cells transfected with UBE2E3 overexpressing plasmid.
-
General notes
Clone OTI4B4 (formerly 4B4).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI4B4 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab128098 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000. Predicted molecular weight: 22 kDa.
|
|
IHC-P |
1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
|
|
ICC/IF |
1/100.
|
|
Flow Cyt (Intra) |
1/100.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
1/2000. Predicted molecular weight: 22 kDa. |
IHC-P
1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. |
ICC/IF
1/100. |
Flow Cyt (Intra)
1/100. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest. -
Tissue specificity
Ubiquitously expressed at low levels. Highly expressed in skeletal muscle. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Belongs to the ubiquitin-conjugating enzyme family. -
Cellular localization
Nucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner. - Information by UniProt
-
Database links
- Entrez Gene: 10477 Human
- Omim: 604151 Human
- SwissProt: Q969T4 Human
- Unigene: 470804 Human
- Unigene: 567831 Human
-
Alternative names
- Homologous to yeast UBC4/5 antibody
- UB2E3_HUMAN antibody
- UBC E4 antibody
see all
Images
-
Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/200 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) extracts at 10 µg
Predicted band size: 22 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE2E3 antibody [OTI4B4] (ab128098)
Paraffin-embedded human endometrium adenocarcinoma tissue stained for UBE2E3 with ab128098 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for UBE2E3 using ab128098 at a 1/100 dilution in ICC/IF.
-
Flow cytometry (Intracellular) analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.
-
Flow cytometry analysis (Intracellular) of Jurkat (Human T cell leukemia cell line from peripheral blood) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.
-
Flow cytometry analysis (Intracellular) of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either UBE2E3 overexpressing plasmid (Red) or empty vector control plasmid (Blue) and immunostained by anti-UBE2E3 antibody (ab128098) at 1/100 dilution.
-
All lanes : Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells were transfected with pCMV6-ENTRY UBE2E3 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 22 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab128098 has been referenced in 1 publication.
- King LE et al. Genes regulating membrane-associated E-cadherin and proliferation in adenomatous polyposis coli mutant colon cancer cells: High content siRNA screen. PLoS One 15:e0240746 (2020). PubMed: 33057364