Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)
![Western blot - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)](https://www.abcam.com/ps/products/39/ab39378/Images/ab39378-316618-anti-vegf-receptor-2-antibody-4-20i6-western-blot.jpg "Western blot - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)")
Key features and details
- Mouse monoclonal [#4 (20I6)] to VEGF Receptor 2
- Suitable for: WB, ICC/IF, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-VEGF Receptor 2 antibody [#4 (20I6)]
See all VEGF Receptor 2 primary antibodies -
Description
Mouse monoclonal [#4 (20I6)] to VEGF Receptor 2 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human VEGF Receptor 2 aa 20-678.
Sequence:ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSG SEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQ DYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKR FVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVV GYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQH KKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNS TFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGI PLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYV PPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANE PSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVI QAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSL WCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSN STNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLGRETILD HCAEAVGMP
Database link: P35968-2 -
Positive control
- WB: Recombinant human VEGF Receptor 2 protein. ICC/IF: HUVEC cells. Flow Cyt: HDLEC cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Centrifuge vial prior to opening. Please reconstitute this product to 0.1-1.0 mg/mL in sterile water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
#4 (20I6) -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab39378 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB |
Use a concentration of 2 - 5 µg/ml. Predicted molecular weight: 110 kDa.
|
|
| ICC/IF |
Use a concentration of 2 - 10 µg/ml.
|
|
| Flow Cyt |
Use a concentration of 2 - 5 µg/ml.
|
| Notes |
|---|
|
WB
Use a concentration of 2 - 5 µg/ml. Predicted molecular weight: 110 kDa. |
|
ICC/IF
Use a concentration of 2 - 10 µg/ml. |
|
Flow Cyt
Use a concentration of 2 - 5 µg/ml. |
Target
-
Function
Receptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. -
Involvement in disease
Defects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 protein kinase domain. -
Post-translational
modificationsPhosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3791 Human
- Omim: 191306 Human
- SwissProt: P35968 Human
- Unigene: 479756 Human
-
Alternative names
- CD309 antibody
- CD309 antigen antibody
- EC 2.7.10.1 antibody
see all
Images
-
Western blot - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)All lanes : Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378) at 5 µg/ml
Lane 1 : Recombinant human VEGF Receptor 2 protein
Lane 2 : Recombinant human VEGF Receptor 2 (aa 20-678) protein
Lane 3 : Recombinant human VEGF Receptor 2 (aa 20-678) protein-Fc
Predicted band size: 110 kDa10% SDS-PAGE gel under reducing conditions.
-
![Flow Cytometry - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)](https://www.abcam.com/ps/products/39/ab39378/Images/ab39378-316620-anti-vegf-receptor-2-antibody-4-20i6-flow-cytometry.jpg)
Flow Cytometry - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)Flow cytometric analysis of HDLEC (primary human dermal lymphatic endothelial cells) labeling VEGF Receptor 2 using ab39378 at 5 μg/ml (red) compared to a negative control (unshaded).
-
![Immunocytochemistry/ Immunofluorescence - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)](https://www.abcam.com/ps/products/39/ab39378/Images/ab39378-316619-anti-vegf-receptor-2-antibody-4-20i6-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378)HUVEC (human umbilical vein endothelial cell line) cells stained for VEGF Receptor 2 (green) using ab39378 at 7.5 μg/ml in ICC/IF. The nuclear counter stain is DAPI (blue).
A Goat anti-Mouse Alexa Fluor®488 conjugate was used as secondary antibody at 1/600 dilution.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab39378 has not yet been referenced specifically in any publications.
