Anti-xCT antibody (ab37185)
Key features and details
- Rabbit polyclonal to xCT
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-xCT antibody
See all xCT primary antibodies -
Description
Rabbit polyclonal to xCT -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human xCT aa 1-50 (N terminal). The exact sequence is proprietary.
Sequence:MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGV
Database link: Q9UPY5 -
Positive control
- ICC/IF: HepG2 cells. IHC-P: Human small intestine tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Affinity purified antibody. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab37185 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P |
Use at an assay dependent concentration.
|
|
| ICC/IF |
1/100 - 1/1000.
|
| Notes |
|---|
|
IHC-P
Use at an assay dependent concentration. |
|
ICC/IF
1/100 - 1/1000. |
Target
-
Function
Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate. -
Sequence similarities
Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 23657 Human
- Omim: 607933 Human
- SwissProt: Q9UPY5 Human
- Unigene: 390594 Human
-
Form
xCT has a predicted molecular weight of 55 kDa; however it has a high number of hydrophobic residues which may affect the migration of the protein in SDS-PAGE. Endogenous monomeric xCT is expected to migrate at ~35 kDa and modified-xCT is expected to migrate at ~55 kDa (PMID: 17035536) -
Alternative names
- Amino acid transport system xc xCT antibody antibody
- Amino acid transport system xc- antibody
- Calcium channel blocker resistance protein CCBR1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-xCT antibody (ab37185)
Imunocytochemistry/ Immunofluorescence analysis of HepG2 cells labeling xCT with ab37185 followed by Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red) respectively.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-xCT antibody (ab37185)Immunohistochemical analysis of human small intestine labeling xCT with ab37185. Staining is observed in the absorptive epithelia of small intestinal villi.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (87)
ab37185 has been referenced in 87 publications.
- Müller F et al. Elevated FSP1 protects KRAS-mutated cells from ferroptosis during tumor initiation. Cell Death Differ 30:442-456 (2023). PubMed: 36443441
- Wei TT et al. Interferon-γ induces retinal pigment epithelial cell Ferroptosis by a JAK1-2/STAT1/SLC7A11 signaling pathway in Age-related Macular Degeneration. FEBS J 289:1968-1983 (2022). PubMed: 34741776
- Sendo K et al. Impact of the glutathione synthesis pathway on sulfasalazine-treated endometrial cancer. Oncotarget 13:224-236 (2022). PubMed: 35106124
- Huang S et al. Hepatic TGFβr1 Deficiency Attenuates Lipopolysaccharide/D-Galactosamine-Induced Acute Liver Failure Through Inhibiting GSK3β-Nrf2-Mediated Hepatocyte Apoptosis and Ferroptosis. Cell Mol Gastroenterol Hepatol 13:1649-1672 (2022). PubMed: 35202887
- Zhang R et al. Curcumenol triggered ferroptosis in lung cancer cells via lncRNA H19/miR-19b-3p/FTH1 axis. Bioact Mater 13:23-36 (2022). PubMed: 35224289