Recombinant Beta Lactamase protein (Tagged) (ab238278)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Beta Lactamase protein (Tagged) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Sequence
GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGL IVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGG MDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFG PLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEH YAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR -
Predicted molecular weight
42 kDa including tags -
Amino acids
29 to 270 -
Tags
His tag N-Terminus -
Additional sequence information
Species: Klebsiella pneumoniae. Full-length mature chain lacking the signal peptide. N-terminal 6xHis-SUMO-tagged
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab238278 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- AmpA
- AmpC
- Cephalosporinase
-
Relevance
The beta lactam antibiotics (penicillins and cephalosporins) are the most frequently used antimicrobial agents. All of the beta lactams are structurally related through the presence of a core beta lactam ring. Bacterial resistance to beta lactams continues to increase, primarily due to the production of beta lactamases. Beta lactamases catalyze the hydrolysis of the beta lactam bond, which destroys antibacterial activity. Bacteria that produce TEM type or SHV type beta lactamases have point mutations in structural genes that have extended the substrate specificity of these beta lactamases. As a result, many of the beta lactamase producing Gram negative pathogens have become multidrug resistant.
Images
-
SDS-PAGE - Recombinant Beta Lactamase protein (Tagged) (ab238278)
ab238278 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant Beta Lactamase protein (Tagged) (ab238278)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238278 could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae Beta Lactamase.
-
Mass Spectrometry - Recombinant Beta Lactamase protein (Tagged) (ab238278)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238278 could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae Beta Lactamase.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab238278 has not yet been referenced specifically in any publications.