Recombinant Cynomolgus monkey PD-L1 protein (Fc Chimera) (ab216195)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Cynomolgus monkey PD-L1 protein (Fc Chimera)
See all PD-L1 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Cynomolgus monkey -
Sequence
KDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDL KVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYK RITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW -
Predicted molecular weight
52 kDa including tags -
Amino acids
25 to 167
-
Specifications
Our Abpromise guarantee covers the use of ab216195 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine), 78% Phosphate Buffer
General Info
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Cynomolgus Monkey PD-L1 protein (Fc Chimera) (ab216195)
4-20% SDS-PAGE analysis of ab216195 (3 μg) with Coomassie staining.
Note: this protein runs at an apparent higher molecular weight due to glycosylation.
-
Size Exclusion Chromatography - Recombinant Cynomolgus monkey PD-L1 protein (Fc Chimera) (ab216195)Gel Filtration Curve.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab216195 has not yet been referenced specifically in any publications.