For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-alpha-smooth-muscle-actin-protein-ab134555.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin
Share by email

Recombinant Human alpha smooth muscle Actin protein (ab134555)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human alpha smooth muscle Actin protein (ab134555)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 85% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: MS, SDS-PAGE

    You may also be interested in

    Primary
    Product image
    Anti-DNAJA2 antibody [EPR11302(B)] (ab157216)
    Primary
    Product image
    Anti-6X His tag® antibody [HIS.H8] (ab18184)
    Primary
    Product image
    Anti-IL-1 beta antibody [EPR21086] - BSA and Azide free (ab229696)

    View more associated products

    Description

    • Product name

      Recombinant Human alpha smooth muscle Actin protein
    • Purity

      > 85 % SDS-PAGE.
      ab134555 is purified using conventional chromatography techniques.
    • Expression system

      Escherichia coli
    • Accession

      P62736
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSHMEEEDSTALVCDNGSGLCKAGFAGDD APRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI ITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFE TFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI MRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEN EMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIH ETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
      • Predicted molecular weight

        44 kDa including tags
      • Amino acids

        3 to 377
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-pan Actin Antibody [4A4] (ab119952)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-alpha smooth muscle Actin antibody (ab21027)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-alpha smooth muscle Actin antibody (ab5694)
      • Anti-alpha smooth muscle Actin antibody [1A4] (ab7817)
      • FITC Anti-alpha smooth muscle Actin antibody [1A4] (ab8211)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab134555 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Mass Spectrometry

      SDS-PAGE

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride

    General Info

    • Alternative names

      • a actin
      • AAT6
      • ACTA_HUMAN
      • ACTA2
      • Actin alpha 2 smooth muscle aorta
      • Actin aortic smooth muscle
      • Actin, aortic smooth muscle
      • ACTSA
      • ACTVS
      • Alpha 2 actin
      • Alpha actin 2
      • Alpha cardiac actin
      • alpha sma
      • Alpha-actin-2
      • Cell growth inhibiting gene 46 protein
      • Cell growth-inhibiting gene 46 protein
      • GIG46
      • Growth inhibiting gene 46
      • MYMY5
      see all
    • Function

      Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
    • Involvement in disease

      Defects in ACTA2 are the cause of aortic aneurysm familial thoracic type 6 (AAT6) [MIM:611788]. AATs are characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. They are primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance.
    • Sequence similarities

      Belongs to the actin family.
    • Cellular localization

      Cytoplasm > cytoskeleton.
    • Target information above from: UniProt accession P62736 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human alpha smooth muscle Actin protein (ab134555)
      SDS-PAGE - Recombinant Human alpha smooth muscle Actin protein (ab134555)
      15% SDS-PAGE analysis of 3 µg ab134555.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (1)

    Publishing research using ab134555? Please let us know so that we can cite the reference in this datasheet.

    ab134555 has been referenced in 1 publication.

    • Gordon O  et al. a-actinin accounts for the bioactivity of actin preparations in inducing STAT target genes in Drosophila melanogaster. Elife 7:N/A (2018). PubMed: 30260317

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab134555.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.