For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-alpha-synuclein-protein-aggregate-type-2-ab218817.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurodegenerative disease Parkinson's disease Synuclein
Share by email

Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
  • SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
  • Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Primary
Product image
Anti-Alpha-synuclein aggregate antibody [MJFR-14-6-4-2] - Conformation-Specific (ab209538)
Primary
Product image
Biotin Anti-Alpha-synuclein aggregate antibody [MJFR-14-6-4-2] - Conformation-Specific (ab227047)
ELISA
Product image
Human Alpha-synuclein ELISA Kit (ab260052)

View more associated products

Description

  • Product name

    Recombinant Human Alpha-synuclein protein aggregate (Type 2)
    See all Alpha-synuclein proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab218817 is purified by ion-exchange and 0.2µm filtered.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

    P37840-1
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
    • Predicted molecular weight

      14 kDa
    • Amino acids

      1 to 140
  • Description

    Recombinant Human Alpha-synuclein protein

Associated products

  • Related Products

    • Thioflavin T, Fluorescent cell-permeable amyloid binding benzothiazole salt (ab120751)
    • Anti-Alpha-synuclein antibody [MJFR1] (ab138501)
    • Anti-Alpha-synuclein antibody [4D6] - BSA and Azide free (ab1903)
    • Recombinant Human Alpha-synuclein protein monomer (Active) (ab218818)
    • Recombinant Human Alpha-synuclein protein aggregate (Active) (ab218819)
    • Anti-Alpha-synuclein antibody [LB 509] (ab27766)

Specifications

Our Abpromise guarantee covers the use of ab218817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab218817 is a protein aggregate which can be used as a control in various assays. 

    Learn more.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 95% PBS

    0.2µm filtered solution

General Info

  • Alternative names

    • Alpha synuclein
    • Alpha-synuclein
    • Alpha-synuclein, isoform NACP140
    • alphaSYN
    • MGC105443
    • MGC110988
    • MGC127560
    • MGC64356
    • NACP
    • Non A beta component of AD amyloid
    • Non A4 component of amyloid
    • Non A4 component of amyloid precursor
    • Non-A beta component of AD amyloid
    • Non-A-beta component of alzheimers disease amyloid , precursor of
    • Non-A4 component of amyloid precursor
    • Non-A4 component of amyloid, precursor of
    • OTTHUMP00000218549
    • OTTHUMP00000218551
    • OTTHUMP00000218552
    • OTTHUMP00000218553
    • OTTHUMP00000218554
    • PARK 1
    • PARK 4
    • PARK1
    • PARK4
    • Parkinson disease (autosomal dominant, Lewy body) 4
    • Parkinson disease familial 1
    • SNCA
    • Snca synuclein
    • Snca synuclein, alpha (non A4 component of amyloid precursor)
    • SYN
    • Synuclein alpha
    • Synuclein alpha 140
    • Synuclein, alpha (non A4 component of amyloid precursor)
    • SYUA_HUMAN
    see all
  • Function

    May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
  • Tissue specificity

    Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
  • Involvement in disease

    Genetic alterations of SNCA resulting in aberrant polymerization into fibrils, are associated with several neurodegenerative diseases (synucleinopathies). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimer disease amyloid plaque, and a major component of Lewy body inclusions. They are also found within Lewy body (LB)-like intraneuronal inclusions, glial inclusions and axonal spheroids in neurodegeneration with brain iron accumulation type 1.
    Parkinson disease 1
    Parkinson disease 4
    Dementia Lewy body
  • Sequence similarities

    Belongs to the synuclein family.
  • Domain

    The 'non A-beta component of Alzheimer disease amyloid plaque' domain (NAC domain) is involved in fibrils formation. The middle hydrophobic region forms the core of the filaments. The C-terminus may regulate aggregation and determine the diameter of the filaments.
  • Post-translational
    modifications

    Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.
    Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.
    Ubiquitinated. The predominant conjugate is the diubiquitinated form.
    Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.
  • Cellular localization

    Cytoplasm, cytosol. Membrane. Nucleus. Cell junction, synapse. Secreted. Membrane-bound in dopaminergic neurons.
  • Target information above from: UniProt accession P37840 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
    Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

    ThT emission curves show increased fluorescence (correlated to alpha-synucleinprotein aggregation) over time when 10 µM of active alpha-synuclein aggregate (ab218819) is combined with 100 µM of active alpha-synuclein monomer (ab218818) (light blue), as compared to when 100 µM of active alpha-synuclein monomer is combined with 10 µM of control alpha-synuclein aggregate (purple line), or 100 µM of control alpha-synuclein monomer (ab218816) is combined with 10 µM of control alpha-synuclein aggregate (ab218817) (dark blue). ThT ex = 450 nm, em = 485 nm. View protocol.

  • SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
    SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

    SDS-PAGE analysis of ab218817.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

    Immunohistochemical analysis of 4% formaldehyde fixed primary rat hippocampal neurons from Sprague-Dawley rat labeling lewy body inclusions formed when treated with active Alpha Synuclein Protein Aggregate at 4 µg/ml (D-F), but not when treated with ab218817 at 4 µg/ml (A-C). 

    Primary antibody: Mouse anti-pSer129 antibody at 1/1000 24 hours at 4°C. Secondary antibody: FITC Goat Anti-Mouse (green) at 1/700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1/4000 for 1 hour at RT. Magnification: 20x.

  • Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)
    Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (ab218817)

    TEM of ab218817.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab218817? Please let us know so that we can cite the reference in this datasheet.

ab218817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab218817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.