Recombinant Human Bax protein (ab173026)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus, His tag N-Terminus
- Suitable for: HPLC, SDS-PAGE
Description
-
Product name
Recombinant Human Bax protein
See all Bax proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGF IQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVP ELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH -
Predicted molecular weight
22 kDa including tags -
Amino acids
1 to 171 -
Tags
His tag C-Terminus , His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab173026 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 64% Sodium chloride, 3% Sodium phosphate monobasic, monohydrate, 28% disodium;hydrogen phosphate;dodecahydrate
Lyophilized from a 0.2 µm filtered solution
General Info
-
Alternative names
- Apoptosis regulator BAX
- BAX
- Bax-protein
see all -
Function
Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. -
Tissue specificity
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. -
Sequence similarities
Belongs to the Bcl-2 family. -
Domain
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family. -
Cellular localization
Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (3)
ab173026 has been referenced in 3 publications.
- Huang Q et al. Chinese Herbal Extracts Exert Neuroprotective Effect in Alzheimer's Disease Mouse Through the Dopaminergic Synapse/Apoptosis Signaling Pathway. Front Pharmacol 13:817213 (2022). PubMed: 35295332
- Meng Y et al. Ononin induces cell apoptosis and reduces inflammation in rheumatoid arthritis fibroblast-like synoviocytes by alleviating MAPK and NF-κB signaling pathways. Acta Biochim Pol 68:239-245 (2021). PubMed: 34075738
- Jia Z et al. Ursolic acid treats renal tubular epithelial cell damage induced by calcium oxalate monohydrate via inhibiting oxidative stress and inflammation. Bioengineered 12:5450-5461 (2021). PubMed: 34506233