For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-bim-protein-ab112387.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular Associated Proteins
Share by email

Recombinant Human Bim protein (ab112387)

  • Datasheet
Submit a review Q&A (1)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Bim protein (ab112387)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: SDS-PAGE, ELISA, WB

    You may also be interested in

    Protein
    Product image
    Recombinant Human Cdk9 protein (ab85603)
    Protein
    Product image
    Recombinant Human Bad protein (ab89848)

    View more associated products

    Description

    • Product name

      Recombinant Human Bim protein
      See all Bim proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      O43521
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSC DKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHS QDTEQLNHKDFS
      • Predicted molecular weight

        39 kDa including tags
      • Amino acids

        1 to 112
      • Tags

        GST tag N-Terminus

    Associated products

    • Related Products

      • Anti-Bim antibody [Y36] (ab32158)

    Specifications

    Our Abpromise guarantee covers the use of ab112387 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      ELISA

      Western blot

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

      Glutathione is reduced

    General Info

    • Alternative names

      • BCL2 like 11
      • B2L11_HUMAN
      • BAM
      • Bcl 2 interacting protein Bim
      • Bcl 2 related ovarian death agonist
      • Bcl-2-like protein 11
      • BCL2 interacting mediator of cell death
      • BCL2 like 11 (apoptosis facilitator)
      • BCL2 like protein 11
      • Bcl2-interacting mediator of cell death
      • Bcl2-L-11
      • Bcl2l11
      • BIM
      • BIM alpha6
      • BIM beta6
      • BIM beta7
      • BimEL
      • BimL
      • BOD
      see all
    • Function

      Induces apoptosis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than the isoforms BimEL, BimL and BimS. Isoform Bim-gamma induces apoptosis.
    • Tissue specificity

      Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.
    • Sequence similarities

      Belongs to the Bcl-2 family.
    • Domain

      The BH3 motif is required for Bcl-2 binding and cytotoxicity.
    • Cellular localization

      Mitochondrion and Endomembrane system. Associated with intracytoplasmic membranes.
    • Target information above from: UniProt accession O43521 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Bim protein (ab112387)
      SDS-PAGE - Recombinant Human Bim protein (ab112387)
      12.5% SDS-PAGE analysis of ab112387. Stained with Coomassie Blue

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (1)

    Publishing research using ab112387? Please let us know so that we can cite the reference in this datasheet.

    ab112387 has been referenced in 1 publication.

    • Cheng Mm W  et al. Role of the mTOR Signalling Pathway in Human Sepsis-Induced Myocardial Dysfunction. Can J Cardiol 35:875-883 (2019). PubMed: 31292086

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Customer kindly contacted us regarding the tag used with this protein. They also asked for any details which we may have regarding ELISA.

    Read More

    Abcam community

    Verified customer

    Asked on Dec 13 2012

    Answer

    This product is Human Bim full-length ORF ( NP_996885.1, 1 a.a. - 112 a.a.) recombinant protein with a proprietary tag. Please contact our scientific support group for more information regarding this tag. We have not done any tests for enzymatic activity yet so we are not sure if the protein is active. We are happy to provide our protocols for ELISA on the protocols tab of the datasheet.

    Read More

    Abcam Scientific Support

    Answered on Dec 13 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.