For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-btk-protein-ab205800.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Tyrosine Kinases Other
Share by email

Recombinant human BTK protein (ab205800)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human BTK protein (ab205800)
  • SDS-PAGE - Recombinant human BTK protein (ab205800)
  • SDS-PAGE - Recombinant human BTK protein (ab205800)
  • Functional Studies - Recombinant human BTK protein (ab205800)
  • SDS-PAGE - Recombinant human BTK protein (ab205800)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: > 75% Densitometry
  • Active: Yes
  • Tags: His tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Protein
Product image
Recombinant human PKC beta 2 protein (ab60841)
Primary
Product image
Anti-Anterior Gradient 2 antibody [EPR3278] (ab76473)
Assay
Product image
Glucose-6-Phosphate Assay Kit (Colorimetric) (ab83426)

View more associated products

Description

  • Product name

    Recombinant human BTK protein
    See all BTK proteins and peptides
  • Biological activity

    The specific activity of ab205800 was determined to be 43 nmol/min/mg.

  • Purity

    > 75 % Densitometry.
    Purity is lot specific. Please contact our technical Support team for details. Affinity purified.
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    Q06187
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRG SKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPY PFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDG QYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKK PLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLP WWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPK DLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMM NLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLE MCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDE YTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSN ILDVMDEES
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1 to 659
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-BTK antibody (ab137503)
    • Anti-BTK antibody (ab137504)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-BTK antibody (ab25971)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab205800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.82% Sodium phosphate, 1.74% Sodium chloride, 25% Glycerol (glycerin, glycerine), 0.002% PMSF, 0.004% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Agammaglobulinaemia tyrosine kinase
    • AGMX 1
    • AGMX1
    • AT
    • ATK
    • B cell progenitor kinase
    • B-cell progenitor kinase
    • BPK
    • Bruton agammaglobulinemia tyrosine kinase
    • Bruton tyrosine kinase
    • Bruton’s Tyrosine Kinase
    • Btk
    • BTK_HUMAN
    • dominant-negative kinase-deficient Brutons tyrosine kinase
    • IMD 1
    • IMD1
    • MGC126261
    • MGC126262
    • OTTHUMP00000063593
    • PSCTK 1
    • PSCTK1
    • truncated Bruton agammaglobulinemia tyrosine kinase
    • Tyrosine protein kinase BTK
    • Tyrosine-protein kinase BTK
    • tyrosine-protein kinase BTK isoform (lacking exon 14
    • XLA
    see all
  • Function

    Plays a crucial role in B-cell ontogeny. Transiently phosphorylates GTF2I on tyrosine residues in response to B-cell receptor cross-linking. Required for the formation of functional ARID3A DNA-binding complexes.
  • Involvement in disease

    Defects in BTK are the cause of X-linked agammaglobulinemia (XLA) [MIM:300755]; also known as X-linked agammaglobulinemia type 1 (AGMX1) or immunodeficiency type 1 (IMD1). XLA is a humoral immunodeficiency disease which results in developmental defects in the maturation pathway of B-cells. Affected boys have normal levels of pre-B-cells in their bone marrow but virtually no circulating mature B-lymphocytes. This results in a lack of immunoglobulins of all classes and leads to recurrent bacterial infections like otitis, conjunctivitis, dermatitis, sinusitis in the first few years of life, or even some patients present overwhelming sepsis or meningitis, resulting in death in a few hours. Treatment in most cases is by infusion of intravenous immunoglobulin.
    Defects in BTK may be the cause of X-linked hypogammaglobulinemia and isolated growth hormone deficiency (XLA-IGHD) [MIM:307200]; also known as agammaglobulinemia and isolated growth hormone deficiency or Fleisher syndrome or isolated growth hormone deficiency type 3 (IGHD3). In rare cases XLA is inherited together with isolated growth hormone deficiency (IGHD).
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
    Contains 1 Btk-type zinc finger.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Autophosphorylated on Tyr-223 and Tyr-551. Phosphorylation of Tyr-223 may create a docking site for a SH2 containing protein.
  • Cellular localization

    Cytoplasm. Membrane. Nucleus.
  • Target information above from: UniProt accession Q06187 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human BTK protein (ab205800)
    Functional Studies - Recombinant human BTK protein (ab205800)
    The specific activity of BTK (ab205800) was determined to be 35 nmol/min/mg as per activity assay protocol and was equivalent to 49 nmol/min/mg as per radiometric assay
  • SDS-PAGE - Recombinant human BTK protein (ab205800)
    SDS-PAGE - Recombinant human BTK protein (ab205800)
    SDS PAGE analysis of ab205800
  • SDS-PAGE - Recombinant human BTK protein (ab205800)
    SDS-PAGE - Recombinant human BTK protein (ab205800)
    SDS PAGE analysis of ab205800
  • Functional Studies - Recombinant human BTK protein (ab205800)
    Functional Studies - Recombinant human BTK protein (ab205800)

    Kinase Assay demonstrating specific activity of ab205800

  • SDS-PAGE - Recombinant human BTK protein (ab205800)
    SDS-PAGE - Recombinant human BTK protein (ab205800)

    SDS-PAGE analysis of ab205800.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab205800? Please let us know so that we can cite the reference in this datasheet.

ab205800 has been referenced in 1 publication.

  • Bittner ZA  et al. BTK operates a phospho-tyrosine switch to regulate NLRP3 inflammasome activity. J Exp Med 218:N/A (2021). PubMed: 34554188

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab205800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.