Recombinant human CD137 protein (Fc Chimera Active) (ab220584)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies, ELISA, Flow Cyt
Description
-
Product name
Recombinant human CD137 protein (Fc Chimera Active)
See all CD137 proteins and peptides -
Biological activity
Measured by its binding ability in ELISA. Immobilized ab220584 at 0.1 μg/mL (100 μL/well) can bind Recombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with a linear range of 0.4-13 ng/mL.
Measured by its binding ability in FACS. Flow Cytometry assay shows that ab220584 can bind to 293T cells overexpressing Human 4-1BBL. The concentration of 4-1BB used is 0.1 μg/mL.
Measured by its binding ability in BLI assay. Loaded ab220584 on Protein A Biosensor, can bind Recombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with an affinity constant of 1.3 nM.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQ -
Predicted molecular weight
43 kDa including tags -
Amino acids
24 to 186 -
Tags
Fc tag C-Terminus -
Additional sequence information
Extracellular domain fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab220584 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
ELISA
Flow Cytometry
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- 4 1BB
- 4 1BB ligand receptor
- 4-1BB ligand receptor
see all -
Function
Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. -
Tissue specificity
Expressed on the surface of activated T-cells. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human CD137 protein (Fc Chimera) (ab220584)
SDS-PAGE analysis of reduced ab220584 stained overnight with Coomassie Blue. The protein migrates as 55-60 kDa due to glycosylation.
-
ELISA - Recombinant Human CD137 protein (Fc Chimera) (ab220584)Immobilized ab220584 at 0.1 μg/mL (100 μL/well) can bind Recombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with a linear range of 0.4-13 ng/mL.
-
ELISA - Recombinant human CD137 protein (Fc Chimera Active) (ab220584)Immobilized ab220584 at 1 μg/mL (100 μL/well) can bind Recombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with a linear range of 0.2-3 ng/mL.
-
Functional Studies - Recombinant Human CD137 protein (Fc Chimera) (ab220584)Loaded ab220584 on Protein A Biosensor, can bind Recombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with an affinity constant of 1.3 nM as determined in BLI assay.
-
Flow Cytometry - Recombinant Human CD137 protein (Fc Chimera) (ab220584)Flow Cytometry assay shows that ab220584 can bind to 293T cells overexpressing Human 4-1BBL. The concentration of 4-1BB used is 0.1 μg/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab220584 has not yet been referenced specifically in any publications.
