For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-cd55-protein-ab168708.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Cell Type Markers CD Non-lineage
Share by email
Bioactive grade

Recombinant human CD55 protein (ab168708)

  • Datasheet
Submit a review Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human CD55 protein (ab168708)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Active: Yes
    • Tags: His tag C-Terminus
    • Suitable for: SDS-PAGE, ELISA

    You may also be interested in

    Primary
    Product image
    Anti-CD55 antibody [EPR6689] (ab133684)
    ELISA
    Product image
    Human DAF ELISA Kit (CD55) (ab256405)
    Pair
    Product image
    Human DAF (CD55) Antibody Pair - BSA and Azide free (ab267679)

    View more associated products

    Description

    • Product name

      Recombinant human CD55 protein
      See all CD55 proteins and peptides
    • Biological activity

      Bioactivity: Measured by binding ability in a functional ELISA. When ab168708 is coated at 1 µg/mL (100 µL/well), the concentration of recombinant Human CD97 that produces 50% of the optimal binding response is found to be approximately 0.15-2.0 µg/mL.
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P08174
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKG SQWSDIEEFC NRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLT CLQNLKWSTA VEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFC LISGSSVQWS DPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHS IYCTVNNDEG EWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPN AQATRSTPVS RTTKHFHETTPNKGSGTTS
      • Predicted molecular weight

        36 kDa including tags
      • Amino acids

        35 to 353
      • Tags

        His tag C-Terminus

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)
      • Anti-CD55 antibody (ab96680)

    Specifications

    Our Abpromise guarantee covers the use of ab168708 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      ELISA

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.40
      Constituent: PBS

      5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

    General Info

    • Alternative names

      • CD 55
      • CD55
      • CD55 antigen
      • CD55 Cromer blood group system
      • CD55 molecule
      • CD55 molecule (Cromer blood group)
      • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
      • Cd55a
      • Complement decay accelerating factor
      • Complement decay-accelerating factor
      • Complement decay-accelerating factor, GPI-anchored
      • CR
      • CROM
      • Cromer Blood Group antigen
      • Cromer blood group system
      • DAF
      • Daf-GPI
      • DAF_HUMAN
      • Daf1
      • Dcay accelerating factor for complement (CD55, Cromer blood group system)
      • Decay accelarating factor 1, isoform CRA_a
      • Decay accelerating factor (GPI-form)
      • Decay Accelerating Factor for Complement
      • Decay accelerating factor GPI-form
      • Decay accelerating factor soluble-form
      • GPI-DAF
      • TC
      see all
    • Function

      This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.
    • Tissue specificity

      Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
    • Sequence similarities

      Belongs to the receptors of complement activation (RCA) family.
      Contains 4 Sushi (CCP/SCR) domains.
    • Domain

      The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3.
    • Post-translational
      modifications

      The Ser/Thr-rich domain is heavily O-glycosylated.
    • Cellular localization

      Cell membrane.
    • Target information above from: UniProt accession P08174 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human CD55 protein (ab168708)
      SDS-PAGE - Recombinant human CD55 protein (ab168708)
      The purity of ab168708 was determined by SDS-PAGE of reduced CD55 and staining overnight with Coomassie Blue

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (2)

    Publishing research using ab168708? Please let us know so that we can cite the reference in this datasheet.

    ab168708 has been referenced in 2 publications.

    • Pérez-Alós L  et al. Combining MAP-1:CD35 or MAP-1:CD55 fusion proteins with pattern-recognition molecules as novel targeted modulators of the complement cascade. FASEB J 33:12723-12734 (2019). PubMed: 31469600
    • Cimmino F  et al. CD55 is a HIF-2a marker with anti-adhesive and pro-invading properties in neuroblastoma. Oncogenesis 5:e212 (2016). PubMed: 27043658

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab168708.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.