Recombinant Human CD81 protein (Tagged) (ab267988)
Key features and details
- Expression system: Mammalian
- Purity: > 85% SDS-PAGE
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CD81 protein (Tagged)
See all CD81 proteins and peptides -
Purity
> 85 % SDS-PAGE. -
Expression system
Mammalian -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTL TALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK -
Predicted molecular weight
25 kDa -
Amino acids
113 to 201 -
Tags
Fc tag C-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab267988 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: PBS, 6% Trehalose
Lyophilized from.
General Info
-
Alternative names
- 26 kDa cell surface protein TAPA 1
- 26 kDa cell surface protein TAPA-1
- 26 kDa cell surface protein TAPA1
see all -
Function
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV. -
Tissue specificity
Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines. -
Involvement in disease
Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6) [MIM:613496]; also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. -
Sequence similarities
Belongs to the tetraspanin (TM4SF) family. -
Post-translational
modificationsNot glycosylated. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab267988 has not yet been referenced specifically in any publications.