Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% Affinity purified
- Endotoxin level: < 1.000 Eu/ml
- Tags: Fc tag C-Terminus
- Suitable for: Indirect ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera)
See all SARS-CoV-2 Spike Glycoprotein S1 proteins and peptides -
Purity
> 95 % Affinity purified. -
Endotoxin level
< 1.000 Eu/ml -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human coronavirus -
Sequence
(Without the proprietary tag) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGY FKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLT PGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG VLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCL IGAEHVNNSYECDIPIGAGICASY -
Predicted molecular weight
101 kDa including tags -
Actual molecular weight
140 kDa including tags -
Amino acids
1 to 674 -
Tags
Fc tag C-Terminus -
Additional sequence information
Sheep Fc-Tag (predominantly monomeric). Sequence Strain: Wuhan-Hu-1. Accession: NCBI: YP_009724390.1
-
Specifications
Our Abpromise guarantee covers the use of ab272105 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Indirect ELISA
SDS-PAGE
-
Form
Liquid -
Additional notes
Predicted molecular weight: 130-140kD, including the Fc tag, Purity >95% SDS-PAGE
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7
Constituent: PBS
Dulbecco’s phosphate buffered saline (DPBS).
Images
-
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)
Indirect ELISA showing primary antibody ab273073 (CR3022, human chimeric) binding to the antigens ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) and ab273068 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Active)). Plates were coated with 100ng/well ab272105 or ab273068 and binding of ab273073 assessed in serial dilution from 200ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)Indirect ELISA showing primary antibody ab277513 (CV30) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277513 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)Indirect ELISA showing primary antibody ab277512 (CV1) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277512 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)Indirect competition ELISA showing competitive binding of primary antibody ab277513 (CV30) to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)Indirect competition ELISA showing competitive binding of primary antibody ab277512 (CV1) to antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
SDS-PAGE - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)SDS-PAGE analysis of ab272105.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (5)
ab272105 has been referenced in 5 publications.
- Botelho CN et al. Evaluation of a photoelectrochemical platform based on strontium titanate, sulfur doped carbon nitride and palladium nanoparticles for detection of SARS-CoV-2 spike glycoprotein S1. Biosens Bioelectron X 11:100167 (2022). PubMed: 35647519
- Padula L et al. Secreted heat shock protein gp96-Ig and OX40L-Fc combination vaccine enhances SARS-CoV-2 Spike (S) protein-specific B and T cell immune responses. Vaccine X 12:100202 (2022). PubMed: 35936992
- Tayyab M et al. A portable analog front-end system for label-free sensing of proteins using nanowell array impedance sensors. Sci Rep 12:20119 (2022). PubMed: 36418852
- Xian H et al. Metformin inhibition of mitochondrial ATP and DNA synthesis abrogates NLRP3 inflammasome activation and pulmonary inflammation. Immunity 54:1463-1477.e11 (2021). PubMed: 34115964
- Du L et al. Loss of SIRT4 promotes the self-renewal of Breast Cancer Stem Cells. Theranostics 10:9458-9476 (2020). PubMed: 32863939
