For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-cox1--cyclooxygenase-1-protein-ab198643.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)
  • Functional Studies - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: >= 90% SDS-PAGE
  • Active: Yes
  • Tags: His-DDDDK tag C-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Primary
Product image
Anti-COX2 / Cyclooxygenase 2 antibody [EP8588] (ab169782)
Primary
Product image
Anti-COX2 / Cyclooxygenase 2 antibody [EPR18377-106] - N-terminal (ab188183)
Protein
Product image
Recombinant human COX2 / Cyclooxygenase 2 protein (ab198646)

View more associated products

Description

  • Product name

    Recombinant human COX1 / Cyclooxygenase 1 protein
  • Biological activity

    Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 µM EDTA) with 5 µM Hematin for 10 min
    then added 100 µM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5
    minutes at room temperature. Reaction volume was 100 μl. Application: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling.

  • Purity

    >= 90 % SDS-PAGE.
    Affinity purified.
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    P23219
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFG LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE FVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFF AQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGK LKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQE YSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDAL EFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFG GEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTELD YKDDDDKHHHHHH
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 599
    • Tags

      His-DDDDK tag C-Terminus
    • Additional sequence information

      NM_000962.

Associated products

  • Related Products

    • Anti-COX1 / Cyclooxygenase 1 antibody [EPR5866] (ab109025)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
    • Anti-COX1 / Cyclooxygenase 1 antibody [EPR5867] (ab133319)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab198643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Abcam has not and does not intend to apply for the REACH Authorisation of customers’ uses of products that contain European Authorisation list (Annex XIV) substances.
    It is the responsibility of our customers to check the necessity of application of REACH Authorisation, and any other relevant authorisations, for their intended uses.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol (glycerin, glycerine), 0.08% Triton X-100, 0.0067% Diethyldithiocarbamate

    Contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • COX 1
    • COX 3
    • COX-1
    • COX1
    • Cox3
    • Cyclooxygenase 1
    • Cyclooxygenase 3, included
    • Cyclooxygenase-1
    • EC 1.14.99.1
    • Partial COX1 proteins, included
    • PCOX1
    • PGG/HS
    • PGH synthase 1
    • PGH1_HUMAN
    • PGHS 1
    • PGHS-1
    • PGHS1
    • PHS 1
    • PHS1
    • Prostaglandin endoperoxide synthase 1
    • Prostaglandin G/H synthase 1
    • Prostaglandin H2 synthase 1
    • Prostaglandin-endoperoxide synthase 1
    • Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
    • PTGHS
    • PTGS1
    see all
  • Function

    May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells.
  • Pathway

    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities

    Belongs to the prostaglandin G/H synthase family.
    Contains 1 EGF-like domain.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Target information above from: UniProt accession P23219 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)
    SDS-PAGE - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)

    4-20% SDS-PAGE analysis of 1.2 µg ab198643 with Coomassie staining.

  • Functional Studies - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)
    Functional Studies - Recombinant human COX1 / Cyclooxygenase 1 protein (ab198643)

    Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 µM EDTA) with 5 µM Hematin for 10 min then added 100 µM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5 minutes at room temperature. Reaction volume was 100 μl.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab198643? Please let us know so that we can cite the reference in this datasheet.

ab198643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab198643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.