Recombinant Human Cytochrome C protein (ab172817)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: HPLC, SDS-PAGE
Description
-
Product name
Recombinant Human Cytochrome C protein
See all Cytochrome C proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYT AANKNKGIIWGEDTL MEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNELEHHHHHH -
Predicted molecular weight
11 kDa -
Amino acids
2 to 105 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
- Anti-Cytochrome C antibody [37BA11] (ab110325)
- Anti-Cytochrome C antibody [EPR1327] (ab133504)
- Anti-Cytochrome C antibody [7H8.2C12] (ab13575)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-Cytochrome C antibody (ab18738)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-Cytochrome C antibody [EP1326-80-5] (ab76107)
- Anti-Cytochrome C antibody [EP1326-80-5-4] (ab76237)
- Anti-Cytochrome C antibody (ab90529)
- Anti-6X His tag® antibody (ab9108)
Specifications
Our Abpromise guarantee covers the use of ab172817 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.24% Tris, 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride
Supplied as a 0.2 µM filtered solution.
General Info
-
Alternative names
- CYC
- CYC_HUMAN
- CYCS
see all -
Function
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases. -
Involvement in disease
Defects in CYCS are the cause of thrombocytopenia type 4 (THC4) [MIM:612004]; also known as autosomal dominant thrombocytopenia type 4. Thrombocytopenia is the presence of relatively few platelets in blood. THC4 is a non-syndromic form of thrombocytopenia. Clinical manifestations of thrombocytopenia are absent or mild. THC4 may be caused by dysregulated platelet formation. -
Sequence similarities
Belongs to the cytochrome c family. -
Post-translational
modificationsBinds 1 heme group per subunit. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172817 has not yet been referenced specifically in any publications.