Recombinant human EGF protein (Active) (ab259398)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: MS, HPLC, SDS-PAGE, Cell Culture, Functional Studies
Description
-
Product name
Recombinant human EGF protein (Active)
See all EGF proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.
-
Purity
>= 95 % SDS-PAGE.
>= 95 % HPLC. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR -
Predicted molecular weight
6 kDa -
Amino acids
971 to 1023 -
Additional sequence information
N-terminal glycine. Full-length mature EGF chain.
-
Specifications
Our Abpromise guarantee covers the use of ab259398 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
HPLC
SDS-PAGE
Cell Culture
Functional Studies
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with Phosphate Buffered saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- Beta urogastrone
- beta-urogastrone
- EGF
see all -
Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941). -
Tissue specificity
Expressed in kidney, salivary gland, cerebrum and prostate. -
Involvement in disease
Hypomagnesemia 4 -
Sequence similarities
Contains 9 EGF-like domains.
Contains 9 LDL-receptor class B repeats. -
Post-translational
modificationsO-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor). -
Cellular localization
Membrane. - Information by UniProt
Images
-
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.
-
SDS-PAGE analysis of ab259398.
-
Purity: 97%
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.
-
(M-Arg) +/- 0.1 Da (loss of C-terminal Arg; calc. mass 6123 Da)
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab259398 has not yet been referenced specifically in any publications.