For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-egf-protein-active-ab259398.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones EGF
Share by email
Premium bioactive grade

Recombinant human EGF protein (Active) (ab259398)

  • Datasheet
  • SDS
Reviews (2) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human EGF protein (Active) (ab259398)
  • SDS-PAGE - Recombinant human EGF protein (Active) (ab259398)
  • HPLC - Recombinant human EGF protein (Active) (ab259398)
  • Mass Spectrometry - Recombinant human EGF protein (Active) (ab259398)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 95% SDS-PAGE
  • Endotoxin level: < 0.005 Eu/µg
  • Active: Yes
  • Suitable for: MS, HPLC, SDS-PAGE, Cell Culture, Functional Studies

You may also be interested in

ELISA
Product image
Human EGF ELISA Kit (ab217772)
Knockout
Product image
Human EGF knockout HeLa cell line (ab261830)
Primary
Product image
Anti-EGF antibody (ab9695)

View more associated products

Description

  • Product name

    Recombinant human EGF protein (Active)
    See all EGF proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.

  • Purity

    >= 95 % SDS-PAGE.
    >= 95 % HPLC.
  • Endotoxin level

    < 0.005 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P01133
  • Protein length

    Full length protein
  • Animal free

    Yes
  • Carrier free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR
    • Predicted molecular weight

      6 kDa
    • Amino acids

      971 to 1023
    • Additional sequence information

      N-terminal glycine. Full-length mature EGF chain.

Specifications

Our Abpromise guarantee covers the use of ab259398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    HPLC

    SDS-PAGE

    Cell Culture

    Functional Studies

  • Form

    Lyophilized
  • Additional notes

    This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at Room Temperature.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with Phosphate Buffered saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

General Info

  • Alternative names

    • Beta urogastrone
    • beta-urogastrone
    • EGF
    • EGF_HUMAN
    • Epidermal growth factor
    • HOMG4
    • OTTHUMP00000219721
    • OTTHUMP00000219722
    • Pro epidermal growth factor
    • URG
    • Urogastrone
    see all
  • Function

    EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
  • Tissue specificity

    Expressed in kidney, salivary gland, cerebrum and prostate.
  • Involvement in disease

    Hypomagnesemia 4
  • Sequence similarities

    Contains 9 EGF-like domains.
    Contains 9 LDL-receptor class B repeats.
  • Post-translational
    modifications

    O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P01133 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human EGF protein (Active) (ab259398)
    Functional Studies - Recombinant human EGF protein (Active) (ab259398)

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.

  • SDS-PAGE - Recombinant human EGF protein (Active) (ab259398)
    SDS-PAGE - Recombinant human EGF protein (Active) (ab259398)

    SDS-PAGE analysis of ab259398.

  • HPLC - Recombinant human EGF protein (Active) (ab259398)
    HPLC - Recombinant human EGF protein (Active) (ab259398)

    Purity: 97%

    The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

  • Mass Spectrometry - Recombinant human EGF protein (Active) (ab259398)
    Mass Spectrometry - Recombinant human EGF protein (Active) (ab259398)

    (M-Arg) +/- 0.1 Da (loss of C-terminal Arg; calc. mass 6123 Da)

    The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab259398? Please let us know so that we can cite the reference in this datasheet.

ab259398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review

Filter by Application

Filter by Ratings

1-2 of 2 Abreviews

it can improve pig embryo efficiency from MII to blastocyst

Excellent
Abreviews
Abreviews
abreview image
Application
Functional Studies
it can improve pig embryo efficiency from MII to blastocyst,and i can gain many blastocyst from its addition.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Dec 21 2021

EGF stimulation of MAPK pathway

Excellent
Abreviews
Abreviews
abreview image
Application
Functional Studies
HeLa cells were serum starved overnight, then stimulated for 30 minutes with 10 ng/mL EGF. Cells were harvested and Western blotting was performed to assess activation of the MAPK pathway (pERK). This EGF protein is functional and leads to an increase in pERK in cells.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jul 14 2021

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.