Recombinant human Flt3 ligand/Flt3L protein (Active) (ab282388)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC, MS, Cell Culture
Description
-
Product name
Recombinant human Flt3 ligand/Flt3L protein (Active)
See all Flt3 ligand/Flt3L proteins and peptides -
Biological activity
Fully biologically active determined by dose dependent proliferation of AML-5 cells.
ED50 for this effect is ≤1.058 ng/ml, corresponding to a specific activity of 9.45 x 105 units/mg.
-
Purity
>= 95 % SDS-PAGE.
>=95% purity by HPLC. -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP -
Predicted molecular weight
18 kDa -
Actual molecular weight
18 kDa -
Molecular weight information
Predicted MW is 18010.63 Da (+/- 10 Da by ESI-TOF). Observed MW is 18011.42, with significant heterogeneity in the protein due to multiple glycoforms. -
Amino acids
27 to 184 -
Additional sequence information
N-terminal glycine.
-
Specifications
Our Abpromise guarantee covers the use of ab282388 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
Mass Spectrometry
Cell Culture
-
Form
Lyophilized -
Additional notes
For research use only and are not intended for diagnositc or therapeutic use, not for use in humans.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- FL
- Flt 3 ligand
- Flt 3L
see all -
Function
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
Functional Studies - Recombinant human Flt3 ligand/Flt3L protein (ab282388)
Functional analysis of ab282388.
Fully biologically active determined by dose dependent proliferation of AML-5 cells.
ED50 for this effect is ≤1.058 ng/ml, corresponding to a specific activity of 9.45 x 105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot: GR3391959-1
-
SDS-PAGE - Recombinant Human Flt3 ligand/Flt3L protein (ab282388)SDS-PAGE analysis of ab282388.
-
Mass Spectrometry - Recombinant Human Flt3 ligand/Flt3L protein (ab282388)Mass determination by ESI-TOF.
Predicted MW is 18010.63 Da. (+/- 10 Da by ESI-TOF). Observed MW is 18011.42 Da. Significant heterogeneity in the protein due to multiple glycoforms.
-
HPLC - Recombinant Human Flt3 ligand/Flt3L protein (ab282388)HPLC analysis of ab282388.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab282388 has not yet been referenced specifically in any publications.
