For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-gfap-protein-ab114149.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Adhesion Proteins Cytoskeletal Proteins Intermediate Filaments
Share by email

Recombinant Human GFAP protein (ab114149)

  • Datasheet
Submit a review Q&A (1)References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human GFAP protein (ab114149)
  • Western blot - Recombinant Human GFAP protein (ab114149)

Key features and details

  • Expression system: Wheat germ
  • Tags: GST tag N-Terminus
  • Suitable for: ELISA, WB, SDS-PAGE

You may also be interested in

Pair
Product image
Human GFAP Matched Antibody Pair Kit (ab222279)
ELISA
Product image
Human GFAP ELISA Kit (ab223867)
Primary
Product image
Anti-GFAP antibody [EP672Y] (ab33922)

View more associated products

Description

  • Product name

    Recombinant Human GFAP protein
    See all GFAP proteins and peptides
  • Expression system

    Wheat germ
  • Accession

    P14136
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      1 to 432
    • Tags

      GST tag N-Terminus

Associated products

  • Related Products

    • Anti-GFAP antibody (ab16997)
    • Human GFAP Matched Antibody Pair Kit (ab222279)
    • Anti-GFAP antibody (ab4674)
    • Anti-GFAP antibody (ab53554)
    • Anti-GFAP antibody (ab7260)

Specifications

Our Abpromise guarantee covers the use of ab114149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • wu:fb34h11
    • ALXDRD
    • cb345
    • etID36982.3
    • FLJ42474
    • FLJ45472
    • GFAP
    • GFAP_HUMAN
    • gfapl
    • Glial fibrillary acidic protein
    • Intermediate filament protein
    • wu:fk42c12
    • xx:af506734
    • zgc:110485
    see all
  • Function

    GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
  • Tissue specificity

    Expressed in cells lacking fibronectin.
  • Involvement in disease

    Defects in GFAP are a cause of Alexander disease (ALEXD) [MIM:203450]. Alexander disease is a rare disorder of the central nervous system. It is a progressive leukoencephalopathy whose hallmark is the widespread accumulation of Rosenthal fibers which are cytoplasmic inclusions in astrocytes. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death usually within the first decade. Infants with Alexander disease develop a leukoencephalopathy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Phosphorylated by PKN1.
  • Cellular localization

    Cytoplasm. Associated with intermediate filaments.
  • Target information above from: UniProt accession P14136 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human GFAP protein (ab114149)
    SDS-PAGE - Recombinant Human GFAP protein (ab114149)
    12.5% SDS-PAGE analysis of ab114149, stained with Coomassie Blue.
  • Western blot - Recombinant Human GFAP protein (ab114149)
    Western blot - Recombinant Human GFAP protein (ab114149)
    Anti-GFAP antibody - Astrocyte Marker (ab48050) at 1 µg/ml + Recombinant Human GFAP protein (ab114149) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 10 seconds

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (3)

Publishing research using ab114149? Please let us know so that we can cite the reference in this datasheet.

ab114149 has been referenced in 3 publications.

  • Gschmack E  et al. Plasma autoantibodies to glial fibrillary acidic protein (GFAP) react with brain areas according to Braak staging of Parkinson's disease. J Neural Transm (Vienna) 129:545-555 (2022). PubMed: 35364741
  • Wu Y  et al. Transcription Factor E2F1 Aggravates Neurological Injury in Ischemic Stroke via microRNA-122-Targeted Sprouty2. Neuropsychiatr Dis Treat 16:2633-2647 (2020). PubMed: 33177827
  • Mohammed M  et al. Microwave-accelerated bioassay technique for rapid and quantitative detection of biological and environmental samples. Biosens Bioelectron 75:420-6 (2016). PubMed: 26356762

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question


I am testing the GFAP function in vitro and wondering if ab114149 is endotoxin free?

Read More

Abcam community

Verified customer

Asked on Mar 12 2014

Answer


With regards to ab114149, we don’t produce the protein with an endotoxin free system, so the recombinant protein is not endotoxin free.

Read More

Abcam Scientific Support

Answered on Mar 12 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.