For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-hif-1-alpha-protein-ab154478.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Hypoxia HIF
Share by email

Recombinant Human HIF-1 alpha protein (ab154478)

  • Datasheet
  • SDS
Submit a review Q&A (1)References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human HIF-1 alpha protein (ab154478)
  • Western blot - Recombinant Human HIF-1 alpha protein (ab154478)
  • ELISA - Recombinant Human HIF-1 alpha protein (ab154478)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 75% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: ELISA, WB, SDS-PAGE

You may also be interested in

ELISA
Product image
Human HIF-1 alpha ELISA Kit (ab171577)
Lysate
Product image
Hela-DFO treated (0.5mM, 24h) Nuclear Lysate (ab180880)
Kit
Product image
Factor VIIIa Activity Assay Kit (Fluorometric) (ab204696)

View more associated products

Description

  • Product name

    Recombinant Human HIF-1 alpha protein
    See all HIF-1 alpha proteins and peptides
  • Purity

    > 75 % SDS-PAGE.
    ab154478 was purified by Ni chromatography and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

    Q16665-2
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTENLYFQGMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYEL AHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNC FYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCD HEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWK VLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKT HHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNY VVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKL KKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPN EKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFT MPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASP ESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIA SPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNV LSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIG
    • Predicted molecular weight

      100 kDa including tags
    • Amino acids

      1 to 735
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-HIF-1 alpha antibody [H1alpha67] (ab1)
    • Human HIF-1 alpha ELISA Kit (ab171577)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-HIF-1 alpha antibody [EP1215Y] (ab51608)
    • Anti-HIF-1 alpha antibody [ESEE122] (ab8366)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab154478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Product was previously marketed under the MitoSciences sub-brand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.61% Tris, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • ARNT interacting protein
    • ARNT-interacting protein
    • Basic helix loop helix PAS protein MOP1
    • Basic-helix-loop-helix-PAS protein MOP1
    • bHLHe78
    • Class E basic helix-loop-helix protein 78
    • HIF 1A
    • HIF 1alpha
    • HIF-1-alpha
    • HIF-1alpha
    • HIF-alpha
    • HIF1
    • HIF1 A
    • HIF1 Alpha
    • HIF1-alpha
    • HIF1A
    • HIF1A_HUMAN
    • hifla
    • Hypoxia inducible factor 1 alpha
    • Hypoxia inducible factor 1 alpha isoform I.3
    • Hypoxia inducible factor 1 alpha subunit
    • Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor
    • Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor)
    • Hypoxia inducible factor1alpha
    • Hypoxia-inducible factor 1-alpha
    • Member of PAS protein 1
    • Member of PAS superfamily 1
    • Member of the PAS Superfamily 1
    • MOP 1
    • MOP1
    • PAS domain-containing protein 8
    • PASD 8
    • PASD8
    see all
  • Function

    Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions activates the transcription of over 40 genes, including, erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP.
  • Tissue specificity

    Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Domain

    Contains two independent C-terminal transactivation domains, NTAD and CTAD, which function synergistically. Their transcriptional activity is repressed by an intervening inhibitory domain (ID).
  • Post-translational
    modifications

    In normoxia, is hydroxylated on Pro-402 and Pro-564 in the oxygen-dependent degradation domain (ODD) by EGLN1/PHD1 and EGLN2/PHD2. EGLN3/PHD3 has also been shown to hydroxylate Pro-564. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Deubiquitinated by USP20. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization.
    In normoxia, is hydroxylated on Asn-803 by HIF1AN, thus abrogating interaction with CREBBP and EP300 and preventing transcriptional activation. This hydroxylation is inhibited by the Cu/Zn-chelator, Clioquinol.
    S-nitrosylation of Cys-800 may be responsible for increased recruitment of p300 coactivator necessary for transcriptional activity of HIF-1 complex.
    Requires phosphorylation for DNA-binding.
    Sumoylated; by SUMO1 under hypoxia. Sumoylation is enhanced through interaction with RWDD3. Desumoylation by SENP1 leads to increased HIF1A stability and transriptional activity.
    Ubiquitinated; in normoxia, following hydroxylation and interaction with VHL. Lys-532 appears to be the principal site of ubiquitination. Clioquinol, the Cu/Zn-chelator, inhibits ubiquitination through preventing hydroxylation at Asn-803.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasmic in normoxia, nuclear translocation in response to hypoxia. Colocalizes with SUMO1 in the nucleus, under hypoxia.
  • Target information above from: UniProt accession Q16665 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human HIF-1 alpha protein (ab154478)
    SDS-PAGE - Recombinant Human HIF-1 alpha protein (ab154478)

    1µg of ab154478 was examined by SDS-PAGE and commassie blue protein stain. Full-length HIF-1-alpha is indicated by the arrow. Purity is judged to be >75%.

    Expected MW is 100kDa.

  • Western blot - Recombinant Human HIF-1 alpha protein (ab154478)
    Western blot - Recombinant Human HIF-1 alpha protein (ab154478)

    ab154478 was examined by western blot with an anti-HIF-1-alpha antibody.

    Lane1: 10ng HIF1 alpha full-length protein (ab154478)

    Block: 4% milk/PBS Primary antibody: anti-HIF-1-alpha (ab51608), 1:1000; 2 hours room temperature. Secondary antibody: anti-Rabbit HRP 1:5000 ECL detection

  • ELISA - Recombinant Human HIF-1 alpha protein (ab154478)
    ELISA - Recombinant Human HIF-1 alpha protein (ab154478)
    ab154478 was tested in the HIF1A Human ELISA Kit (ab117996). ab154478 was tested under standard conditions in the sandwich ELISA kit using a 3-fold dilution series from 3µg/ml.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (3)

Publishing research using ab154478? Please let us know so that we can cite the reference in this datasheet.

ab154478 has been referenced in 3 publications.

  • Duda P  et al. The Reverse Warburg Effect is Associated with Fbp2-Dependent Hif1a Regulation in Cancer Cells Stimulated by Fibroblasts. Cells 9:N/A (2020). PubMed: 31947613
  • Sil S  et al. HIV-1 Tat-mediated astrocytic amyloidosis involves the HIF-1a/lncRNA BACE1-AS axis. PLoS Biol 18:e3000660 (2020). PubMed: 32453744
  • Chen X  et al. Hypoxia inducible factor and microvessels in peri-implantation endometrium of women with recurrent miscarriage. Fertil Steril 105:1496-1502.e4 (2016). PubMed: 27018158

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question

I noticed that there are 116 additional residues before the His-tag in the N-terminal and 38 additional residues after the His-tag and before start of the protein sequence. I would like to know the functionality and rationality behind attaching these constructs. I would like to use the protein in a functional assay and would also like to know if you have any data regarding binding affinity, turnover rate, and such.

Read More

Abcam community

Verified customer

Asked on Nov 20 2014

Answer

HIF1alpha is a large protein to express recombinantly in E.coli so a few elements were added to aid in expression/solubility/purification. This construct has an N-terminal Trx – His Tag followed by a linker and a TEV cleavage site.

-Trx (thioredoxin) added to aid solubility.
-HIS for affinity purification
-TEV cleavage site (ENLYFQG) added as a way to remove the tag from the HIF sequence by adding highly purified TEV protease.

We know this protein is recognized by anti-HIF antibodies on western blot and is functional in a sandwich ELISA, however we do not have any functional data for this construct.

Read More

Jeremy Kasanov

Abcam Scientific Support

Answered on Nov 20 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.