Recombinant Human Histone H1 protein (ab198676)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Histone H1 protein -
Purity
>= 90 % SDS-PAGE.
Affinity purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAG SSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFR LAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVK KAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK -
Predicted molecular weight
22 kDa including tags -
Amino acids
2 to 194 -
Tags
His tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab198676 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 20% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- dJ221C16.2
- dJ221C16.5
- DmeH1
see all -
Function
May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling. -
Tissue specificity
Oocyte-specific. -
Sequence similarities
Belongs to the histone H1/H5 family.
Contains 1 H15 (linker histone H1/H5 globular) domain. -
Cellular localization
Cytoplasm. Nucleus. Chromosome. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Histone H1 protein (ab198676)
4-20% SDS-PAGE analysis of ab198676 (2 μg) with Coomassie staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab198676 has been referenced in 4 publications.
- Deckard CE & Sczepanski JT Reversible chromatin condensation by the DNA repair and demethylation factor thymine DNA glycosylase. Nucleic Acids Res 49:2450-2459 (2021). PubMed: 33733652
- Tepper S et al. Restriction of AID activity and somatic hypermutation by PARP-1. Nucleic Acids Res 47:7418-7429 (2019). PubMed: 31127309
- Bury M et al. NFE2L3 Controls Colon Cancer Cell Growth through Regulation of DUX4, a CDK1 Inhibitor. Cell Rep 29:1469-1481.e9 (2019). PubMed: 31693889
- Lei T et al. Cyclin K regulates prereplicative complex assembly to promote mammalian cell proliferation. Nat Commun 9:1876 (2018). PubMed: 29760377