Recombinant Human Histone H2A.Z protein (ab114184)
Key features and details
- Expression system: Wheat germ
- Suitable for: SDS-PAGE, ELISA, WB
Description
-
Product name
Recombinant Human Histone H2A.Z protein
See all Histone H2A.Z proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGAT AAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL IKATIAGGGVIPHIHKSLIGKKGQQKTV -
Predicted molecular weight
40 kDa including tags -
Amino acids
1 to 128
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab114184 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- H2A histone family member Z
- H2A.z
- H2A/z
see all -
Function
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division. -
Sequence similarities
Belongs to the histone H2A family. -
Post-translational
modificationsMonoubiquitination of Lys-122 gives a specific tag for epigenetic transcriptional repression.
Acetylated on Lys-5, Lys-8 and Lys-12 during interphase. Acetylation disappears at mitosis.
Monomethylated on Lys-5 and Lys-8 by SETD6. SETD6 predominantly methylates Lys-8, lys-5 being a possible secondary site.
Not phosphorylated. -
Cellular localization
Nucleus. Chromosome. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab114184 has not yet been referenced specifically in any publications.