For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-hsp90-beta-protein-active-ab80033.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Trafficking Chaperones Heat Shock Proteins
Share by email

Recombinant human Hsp90 beta protein (Active) (ab80033)

  • Datasheet
Submit a review Q&A (1)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Recombinant human Hsp90 beta protein (ab80033)
  • SDS-PAGE - Recombinant human Hsp90 beta protein (Active) (ab80033)

Key features and details

  • Expression system: Baculovirus infected BTI-TN-5B1-4 cells
  • Purity: > 90% SDS-PAGE
  • Active: Yes
  • Suitable for: WB, ELISA, Inhibition Assay, Functional Studies, SDS-PAGE

You may also be interested in

Conjugation
Product image
DyLight® 633 Conjugation Kit (Fast) - Lightning-Link® (ab201802)
Primary
Product image
Anti-CCK2-R antibody (ab77077)

View more associated products

Description

  • Product name

    Recombinant human Hsp90 beta protein (Active)
    See all Hsp90 beta proteins and peptides
  • Biological activity

    1. The reactions are in 33 mM Hepes pH7.2, 30 mM NaCl, 5 mM MgCl2, 1 mM DTT, 1.5 mM ATP in a 100 µl reaction at 37ºC. It is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm.

    2. The protein concentrations (where applicable) were 2 µM Hsp90 (Hsp90 beta), 2 µM Ahsa1 (His tagged human Ahsa1), 4 µM p23 (cleaved human p23), 4 µM HOP (His-tagged human HOP).

    3. Addition of a two-fold excess of p23 reduced Aha1-mediated Hsp90 stimulation by 30% (when using 2 µM Hsp90 and Aha1).

    4. Addition of a two -fold excess of HOP completely eliminated Aha1-mediated ATPase stimulation as well as intrinsic Hsp90 ATPase activity.

  • Purity

    > 90 % SDS-PAGE.
    ab80033 is Affinity Purified, Endotoxin-free
  • Expression system

    Baculovirus infected BTI-TN-5B1-4 cells
  • Accession

    P08238
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA LDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLIN NLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHN DDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKE VVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKI EDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKI LKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRR LSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFV ERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEK KKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKA VKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP NAAVPDEIPPLEGDEDASRMEEVD
    • Predicted molecular weight

      90 kDa
    • Amino acids

      1 to 724

Associated products

  • Related Products

    • Anti-Hsp90 beta antibody [H90-10] (ab53497)

Specifications

Our Abpromise guarantee covers the use of ab80033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    Inhibition Assay

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab80033 is endotoxin free. <0.1 EU/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 0.0154% DTT, 0.242% Tris, 0.00292% EDTA, 10% Glycerol (glycerin, glycerine), 1.015% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 90 kda heat shock protein beta HSP90 beta
    • D6S182
    • FLJ26984
    • Heat shock 84 kDa
    • Heat shock 90kD protein 1, beta
    • Heat shock 90kDa protein 1 beta
    • Heat shock protein 90 alpha family class B member 1
    • Heat shock protein 90 kDa
    • Heat shock protein 90kDa alpha (cytosolic) class B member 1
    • Heat shock protein 90kDa alpha family class B member 1
    • Heat shock protein beta
    • Heat shock protein HSP 90 beta
    • Heat shock protein HSP 90-beta
    • HS90B_HUMAN
    • HSP 84
    • HSP 90
    • HSP 90 b
    • HSP 90b
    • HSP84
    • HSP90 BETA
    • hsp90ab1
    • HSP90B
    • HSPC2
    • HSPCB
    see all
  • Function

    Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
  • Sequence similarities

    Belongs to the heat shock protein 90 family.
  • Domain

    The TPR repeat-binding motif mediates interaction with TPR repeat-containing proteins.
  • Post-translational
    modifications

    Ubiquitinated in the presence of STUB1-UBE2D1 complex (in vitro).
    ISGylated.
    S-nitrosylated; negatively regulates the ATPase activity.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Target information above from: UniProt accession P08238 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Western blot - Recombinant human Hsp90 beta protein (ab80033)
    Western blot - Recombinant human Hsp90 beta protein (ab80033)
  • SDS-PAGE - Recombinant human Hsp90 beta protein (Active) (ab80033)
    SDS-PAGE - Recombinant human Hsp90 beta protein (Active) (ab80033)

    SDS-PAGE of Hsp90 beta protein (ab80033).

     

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (1)

Publishing research using ab80033? Please let us know so that we can cite the reference in this datasheet.

ab80033 has been referenced in 1 publication.

  • Liu S  et al. A method to measure the denatured proteins in the corona of nanoparticles based on the specific adsorption of Hsp90ab1. Nanoscale 12:15857-15868 (2020). PubMed: 32696774

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question


 
Why not is this protein sorted in the His-Tag products?

Read More

Abcam community

Verified customer

Asked on Apr 18 2018

Answer


The ab80033 Recombinant human Hsp90 beta protein does not have any tags.

Read More

Abcam Scientific Support

Answered on Apr 18 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.