Recombinant Human Iba1 protein (ab105593)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human Iba1 protein
See all Iba1 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab105593 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMSQTRDLQGGKAFGLLKAQQEERLDEINKQ FLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVP KTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKARE KEKPTGPPAKKAISELP -
Predicted molecular weight
19 kDa including tags -
Amino acids
1 to 147 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab105593 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride
General Info
-
Alternative names
- AIF 1
- AIF-1
- Aif1
see all -
Function
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. -
Tissue specificity
Detected in T-lymphocytes and peripheral blood mononuclear cells. -
Sequence similarities
Contains 2 EF-hand domains. -
Post-translational
modificationsPhosphorylated on serine residues. -
Cellular localization
Cytoplasm > cytoskeleton. Cell projection > ruffle membrane. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab105593 has been referenced in 2 publications.
- Fader KA et al. Circulating neurofilament light chain as a promising biomarker of AAV-induced dorsal root ganglia toxicity in nonclinical toxicology species. Mol Ther Methods Clin Dev 25:264-277 (2022). PubMed: 35505662
- Erisgin Z Melamine exposure from the weaning period causes apoptosis, inflammation, and damage to the blood-brain barrier. J Chem Neuroanat 113:101939 (2021). PubMed: 33639231