For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-ifngr1-protein-ab181887.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Recombinant Human IFNGR1 protein (ab181887)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human IFNGR1 protein (ab181887)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Suitable for: SDS-PAGE

    You may also be interested in

    Protein
    Recombinant Human Cathepsin E protein (ab151880)
    ELISA
    Product image
    Human Interferon gamma Receptor 1 ELISA Kit (CD119) (ab173193)
    Primary
    Product image
    Anti-RAB22A antibody [EPR9487] - BSA and Azide free (ab248852)

    View more associated products

    Description

    • Product name

      Recombinant Human IFNGR1 protein
      See all IFNGR1 proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P15260
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKE EKQIMIDIFHPSVFVNGDEQEVDYDPET TCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCV SAEGVLHVWGVTTEKSKEVCITIFNSSIKG
      • Predicted molecular weight

        52 kDa including tags
      • Amino acids

        18 to 245
      • Additional sequence information

        Fused with Fc fragment of Human IgG1 at the C-terminus (AAH05333).

    Specifications

    Our Abpromise guarantee covers the use of ab181887 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

      pH: 7.4
      Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

    General Info

    • Alternative names

      • Antiviral Protein Type II
      • Antiviral protein, type 2
      • AVP type II
      • AVP, type 2
      • CD 119
      • CD119
      • CD119 antigen
      • CDw119
      • FLJ45734
      • IFN gamma R
      • IFN gamma R alpha
      • IFN gamma R1
      • IFN-gamma receptor 1
      • IFN-gamma-R1
      • IFNG R1
      • IFNGR
      • IFNGR 1
      • IFNGR1
      • Immune interferon receptor 1
      • Immune interferon receptor for
      • INGR1_HUMAN
      • Interferon gamma receptor 1
      • Interferon gamma receptor alpha chain
      • Interferon gamma receptor alpha chain precursor
      see all
    • Function

      Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
    • Involvement in disease

      Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
    • Sequence similarities

      Belongs to the type II cytokine receptor family.
      Contains 2 fibronectin type-III domains.
      Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    • Post-translational
      modifications

      Phosphorylated at Ser/Thr residues.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P15260 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human IFNGR1 protein (ab181887)
      SDS-PAGE - Recombinant Human IFNGR1 protein (ab181887)

      SDS-PAGE analysis of ab181887 stained overnight with Coomassie Blue. 

      Lane 1: DTT-reduced

      Lane 2: Non-reduced 

       

      As a result of glycosylation, DTT-reduced protein migrates as 75-100 kDa and non-reduced protein migrates as 150-170 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (1)

    Publishing research using ab181887? Please let us know so that we can cite the reference in this datasheet.

    ab181887 has been referenced in 1 publication.

    • Qiao LN  et al. Effect of electroacupuncture on thermal pain threshold and expression of calcitonin-gene related peptide, substance P and ?-aminobutyric acid in the cervical dorsal root ganglion of rats with incisional neck pain. Acupunct Med 35:276-283 (2017). PubMed: 28600329

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab181887.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.