Recombinant Human IGF2 protein (Active) (ab283420)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, MS, HPLC, Cell Culture, Biological Activity
Description
-
Product name
Recombinant Human IGF2 protein (Active)
See all IGF2 proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of MCF7 cells. ED50 is ≤5.8 ng/mL, corresponding to a specific activity of 1.72 x 105 units/mg.
-
Purity
>= 95 % HPLC. -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE -
Predicted molecular weight
20 kDa -
Amino acids
25 to 91 -
Additional sequence information
N-terminal glycine.
-
-
Description
Human IGF2 protein
Specifications
Our Abpromise guarantee covers the use of ab283420 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
HPLC
Cell Culture
Biological Activity
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionStore lyophilized form at room temperature. Reconstitute in PBS, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- C11orf43
- IGF 2
- IGF II
see all -
Function
The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.
Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. -
Involvement in disease
Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS) [MIM:180860]. SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. -
Sequence similarities
Belongs to the insulin family. -
Post-translational
modificationsO-glycosylated with a core 1 or possibly core 8 glycan. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Biological Activity - Recombinant Human IGF2 protein (Active) (ab283420)
Functional analysis of ab283420.
Fully biologically active determined by the dose dependent proliferation of MCF7 cells. ED50 is ≤5.8 ng/mL, corresponding to a specific activity of 1.72 x 105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot GR3430138-2
-
SDS-PAGE - Recombinant Human IGF2 protein (ab283420)SDS-PAGE analysis of ab283420.
-
Mass Spectrometry - Recombinant Human IGF2 protein (ab283420)Mass determination by ESI-TOF.
Predicted MW is 7532.52 (+/- 10Da by ESI-TOF). MW observed 7532.89.
-
HPLC - Recombinant Human IGF2 protein (ab283420)HPLC analysis of ab283420.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab283420 has not yet been referenced specifically in any publications.
