Recombinant Human IgG1 Fc Protein, His Tag (Active) (ab219660)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human IgG1 Fc Protein, His Tag (Active)
See all IgG1 proteins and peptides -
Biological activity
Loaded Biotinylated Human CD64, His,Avitag can bind ab219660 with an affinity constant of 1.60 nM as determined in BLI assay.
-
Purity
> 95 % SDS-PAGE.
Purified by Immobilized metal affinity chromatography. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK -
Predicted molecular weight
27 kDa including tags -
Amino acids
99 to 330 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
- Human IgG1 ELISA Kit (ab100548)
- Anti-IgG1 antibody [EPR4417] (ab108969)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-6X His tag® antibody (ab9108)
- Mouse monoclonal [4E3] Anti-Human IgG1 hinge heavy chain (ab99771)
- Mouse monoclonal [4E3] Anti-Human IgG1 hinge heavy chain (PE) (ab99776)
Specifications
Our Abpromise guarantee covers the use of ab219660 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.4
Constituents: 5% Trehalose, 0.61% Tris, Glycine, Sodium chloride, L-ArginineThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Ig gamma 1 chain C region
- IgG heavy chain locus
- IGHG1
see all -
Relevance
There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant). -
Cellular localization
Secreted. Cell membrane; Single-pass membrane protein
Images
-
SDS-PAGE - Recombinant Human IgG1 Fc Protein, His Tag (Active) (ab219660)
SDS-PAGE of reduced ab219660 stained overnight with Coomassie Blue. The protein migrates at 30-33 kDa due to glycosylation.
-
Biological Activity - Recombinant Human IgG1 Fc Protein, His Tag (Active) (ab219660)Loaded Biotinylated Human CD64, His,Avitag on SA Biosensor, can bind ab219660 with an affinity constant of 1.60 nM as determined in BLI assay.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab219660 has been referenced in 1 publication.
- Hultström M et al. Angiopoietin-2 Inhibition of Thrombomodulin-Mediated Anticoagulation-A Novel Mechanism That May Contribute to Hypercoagulation in Critically Ill COVID-19 Patients. Biomedicines 10:N/A (2022). PubMed: 35740360
