Recombinant Human IgG4 Fc Protein, Tag Free (Active) (ab181968)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human IgG4 Fc Protein, Tag Free (Active)
See all IgG4 proteins and peptides -
Biological activity
Human FCGRT&B2M Heterodimer Protein, His Tag (SPR & BLI verified) captured on CM5 Chip via anti-His antibody can bind ab181968 with an affinity constant of 0.715 μM as determined in SPR assay (Biacore).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ EGNVFSCSVMHEALHNHYTQKSLSLSLGK -
Predicted molecular weight
26 kDa -
Amino acids
99 to 327 -
Additional sequence information
Fc Region.
-
-
Description
Recombinant human IgG4 protein (Active)
Specifications
Our Abpromise guarantee covers the use of ab181968 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Surface Plasmon Resonance
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.4
Constituents: 0.41% Tris, 0.51% Glycine, 6.8% Trehalose, 0.04% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 500 µg/ml.
General Info
-
Alternative names
- Ig gamma 4 chain C region
- IGHG4
- immunoglobulin heavy chain constant region gamma 4
see all -
Relevance
IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Human IgG4 protein (ab181968)
SDS-PAGE of DDT-reduced (lane 1) and non-reduced (lane 2) ab181968 stained overnight with Coomassie Blue.
As a result of glycosylation, DTT-reduced (R) protein migrates as 30-32 kDa and non-reduced (NR) protein migrates as 28-30 and 55-60 kDa.
-
Surface Plasmon Resonance - Recombinant human IgG4 protein (Active) (ab181968)Human FCGRT&B2M Heterodimer Protein, His Tag (SPR & BLI verified) captured on CM5 Chip via anti-His antibody can bind ab181968 with an affinity constant of 0.715 μM as determined in SPR assay (Biacore).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab181968 has not yet been referenced specifically in any publications.
