Recombinant human IL-10 protein (Active) (ab259402)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, MS, HPLC, SDS-PAGE, Cell Culture
Description
-
Product name
Recombinant human IL-10 protein (Active)
See all IL-10 proteins and peptides -
Biological activity
Fully biologically active, as determined by dose dependant stimulation of human MC/9 cells.
ED50 is ≤ 3 ng/ mL , corresponding to a specific activity of 3.33 x 105 units/mg.
-
Purity
>= 95 % SDS-PAGE.
Purity by HPLC >=95%. -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRR CHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMK IRN -
Predicted molecular weight
18 kDa -
Molecular weight information
M+0.17 Da (Calc. mass 17991.83 Da). -
Amino acids
26 to 178
-
Specifications
Our Abpromise guarantee covers the use of ab259402 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
Mass Spectrometry
HPLC
SDS-PAGE
Cell Culture
-
Form
Lyophilized -
Additional notes
This product will no longer be available once inventory is depleted. It is being replaced by ab284660. This protein has an improved amino acid sequence, 19-178, matching the mature full length IL-10 protein.
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- CSIF
- Cytokine synthesis inhibitory factor
- GVHDS
see all -
Function
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. -
Tissue specificity
Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Fully biologically active, as determined by dose dependant stimulation of human MC/9 cells.
ED50 is ≤ 3 ng/ mL , corresponding to a specific activity of 3.33 x 105 units/mg.
-
SDS-PAGE analysis of ab259402.
-
Purity = 97%.
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50°C.
-
M+0.17 Da (Calc. mass 17991.83 Da).
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60°C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab259402 has been referenced in 1 publication.
- Li F et al. Vascular restenosis reduction with platelet membrane coated nanoparticle directed M2 macrophage polarization. iScience 25:105147 (2022). PubMed: 36274932